DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and HNRNPA3

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001317178.1 Gene:HNRNPA3 / 220988 HGNCID:24941 Length:378 Species:Homo sapiens


Alignment Length:377 Identity:138/377 - (36%)
Similarity:178/377 - (47%) Gaps:69/377 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKT 89
            ||....|:|......|...:......|.   ||||:||||:|||:..||:||.|:|.:....|..
Human     7 PGRPQPDSGRRRRRRGEEGHDPKEPEQL---RKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMR 68

  Fly    90 DPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARHG-----------KIFVGGL 143
            ||||.|||||.|:.::..|.:|....|..|.::.:.|:||:|.:|..           ||||||:
Human    69 DPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGI 133

  Fly   144 TTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDV 208
            ..:..:..::.||.::|.|..:|:..|:|..:::||.|:|||....|..::......|.|...:|
Human   134 KEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEV 198

  Fly   209 KRATPKPENQMMGGMRGGPRGGMRG----------------GRGG-YGGRGGYNNQWDG-QGSYG 255
            |:|..|.|.|..|..||  |||..|                |||| :||||||.....| :||||
Human   199 KKALSKQEMQSAGSQRG--RGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYG 261

  Fly   256 GYGGGY-------------------GGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGG 301
            |..|||                   ||||.||.|....||.|.| ..|||||..||.|.|..|||
Human   262 GGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGG-GGGYDGYNEGGNFGGGNYGG 325

  Fly   302 GGG---------------GNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGGRQ 338
            ||.               |.|.||..|.|..|.|.|||..:||...|.|.|:
Human   326 GGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 31/70 (44%)
RRM2_hnRNPD_like 137..211 CDD:240775 24/73 (33%)
HNRNPA3NP_001317178.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 6/30 (20%)
RRM1_hnRNPA_like 36..113 CDD:409992 35/76 (46%)
RRM2_hnRNPA3 126..205 CDD:409996 25/78 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225 10/22 (45%)
HnRNPA1 331..>347 CDD:402981 1/15 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..378 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.