DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and sqd-1

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001380080.1 Gene:sqd-1 / 177392 WormBaseID:WBGene00022235 Length:308 Species:Caenorhabditis elegans


Alignment Length:302 Identity:118/302 - (39%)
Similarity:157/302 - (51%) Gaps:36/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQT 93
            ||:|......||.|.       :.::|:|:||||:|.|...::|..||.:|||:....||.|...
 Worm     9 NGNASETIKENGHST-------KGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTN 66

  Fly    94 GRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARHG-KIFVGGLTTEISDEEIKTYFG 157
            ||||||||:.||..|......||.|..|..|.|:.|.||:|.. |:|||||.::.|:::::::|.
 Worm    67 GRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRENKKVFVGGLPSDYSEQDLRSHFE 131

  Fly   158 QFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGG 222
            |||.:.::|.|||||...|:.|.||.|:.|:.........||....:|.|||:|.|:      |.
 Worm   132 QFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ------GK 190

  Fly   223 MRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGG-GYGGYGAGG--YGDYYAGGYY------ 278
            ...|.:|.|.||||.||||||.||    .|.|.|:|. |...|||.|  :||:|..|||      
 Worm   191 RFPGAQGRMPGGRGMYGGRGGNNN----SGWYAGWGQIGAMPYGATGAAWGDWYGNGYYGQQGAA 251

  Fly   279 --------NGYDYGYDGY-GYGGGFEGNGYGGGGGGNMGGGR 311
                    .||..||..: |...||:.....|...||.|..|
 Worm   252 HHNNSGSSQGYGSGYQSFAGNNSGFDYQQAQGARQGNNGQPR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 32/70 (46%)
RRM2_hnRNPD_like 137..211 CDD:240775 29/73 (40%)
sqd-1NP_001380080.1 RRM2_NsCP33_like 30..104 CDD:410187 34/73 (47%)
RRM_SF 111..185 CDD:418427 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I7046
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I2561
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45859
OrthoDB 1 1.010 - - D1055256at2759
OrthoFinder 1 1.000 - - FOG0001417
OrthoInspector 1 1.000 - - oto17480
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4769
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.