DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and hrpa-1

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001040945.1 Gene:hrpa-1 / 177101 WormBaseID:WBGene00001999 Length:347 Species:Caenorhabditis elegans


Alignment Length:343 Identity:129/343 - (37%)
Similarity:175/343 - (51%) Gaps:52/343 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIV 103
            |||.|    ||.:.::.||:|||||:..||:..:|:.:.::|||..|.|..||.|.|||||.|:.
 Worm    10 NGSGD----ASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVT 70

  Fly   104 FTNTEAIDKVSAADEHIINSKKVDPKKAKARHGK-----------IFVGGLTTEISDEEIKTYFG 157
            |:....:|.......|||:.|.||||:|..|..|           ::|.|:..:.:::.:..||.
 Worm    71 FSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFT 135

  Fly   158 QFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE------ 216
            ::|.:.:.|:..||...:.:||.|:|||....|...:......:.|...||::...|.|      
 Worm   136 KYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQM 200

  Fly   217 ---NQMMGG-MRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGG-YGGGYGGYGAGGYGDYYAGG 276
               .:..|| .|.|.|||..||.||.||.|| ..|..|.|:||| .|||.||||.|.||    ||
 Worm   201 NRDRETRGGRSRDGQRGGYNGGGGGGGGWGG-PAQRGGPGAYGGPGGGGQGGYGGGNYG----GG 260

  Fly   277 YYNGYDYGYDGYGYGGGFEG--NGYGGGGGGNMGGGR----GGPR-----GGGGPK---GGGGFN 327
                  :|..|.|..||:.|  ...||||.|..|||.    |||:     |.|||:   ||||:.
 Worm   261 ------WGQQGGGGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWG 319

  Fly   328 G-GKQRGGGGRQQRHQPY 344
            | |:|:||.|.|...|.:
 Worm   320 GQGQQQGGWGGQSGAQQW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 30/70 (43%)
RRM2_hnRNPD_like 137..211 CDD:240775 19/84 (23%)
hrpa-1NP_001040945.1 RRM1_hnRNPA_like 24..101 CDD:241022 34/76 (45%)
RRM2_hnRNPA_like 115..187 CDD:240774 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.