DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Msi1

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_032655.1 Gene:Msi1 / 17690 MGIID:107376 Length:362 Species:Mus musculus


Alignment Length:222 Identity:86/222 - (38%)
Similarity:122/222 - (54%) Gaps:14/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118
            |..|:|:|||||:||::.||::||::||::...|..||.|.|||||.|:.|.:...:|||.|...
Mouse    18 DPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSR 82

  Fly   119 HIINSKKVDPK---------KAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKS 174
            |.::||.:|||         |...|..|||||||:...:.|::|.||.|||.:.:..:.|||..:
Mouse    83 HELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTN 147

  Fly   175 QRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPR---GGMRGGRG 236
            :.:||.|:||:||.:|..:.:....:|..|.|:.|:|.||......|..||..|   .||.....
Mouse   148 RHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFML 212

  Fly   237 GYG--GRGGYNNQWDGQGSYGGYGGGY 261
            |.|  |..|:........||.|...||
Mouse   213 GIGMLGYPGFQATTYASRSYTGLAPGY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 33/70 (47%)
RRM2_hnRNPD_like 137..211 CDD:240775 29/73 (40%)
Msi1NP_032655.1 RRM1_MSI 22..96 CDD:241020 35/73 (48%)
PABP-1234 <32..312 CDD:130689 77/208 (37%)
RRM2_MSI 110..183 CDD:240769 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.