DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and tdp-1

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001254189.1 Gene:tdp-1 / 174436 WormBaseID:WBGene00006514 Length:414 Species:Caenorhabditis elegans


Alignment Length:252 Identity:58/252 - (23%)
Similarity:106/252 - (42%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TADGPGSENGDAGAAGSTNGSSDNQSAASG-----QRDDDR-KLFVGGLSWETTEKELRDHFGKY 79
            :||...::....|::..:: |.|.:...||     :||... .|.|.|:.::||::..:.:|...
 Worm   133 SADATSAKRRKVGSSDDSD-SDDGRDGRSGRKRAVERDSQPVDLIVLGVDFKTTDECFQKYFEDI 196

  Fly    80 GEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--------- 135
            |.:....:|. ...|.|:||.|:..::....:||.|..:|:|:.::.|.|....|.         
 Worm   197 GTVVFCEIKR-KSDGNSKGFGFVRMSSVGEQNKVLAIPQHMIDGRRCDVKVPDGRSLQDKQGRPS 260

  Fly   136 -GKIFVGGLTTEISDEEIKTYFG-QFGNIVE--------VEMPFDKQKSQRKGFCFITFDSEQVV 190
             .:||||.||.::.:.:::..|| :..:.:|        :..||       :||.|:|..|.:..
 Worm   261 ISRIFVGRLTDKVDEHQLRKVFGDEAKSYIETAVVTDVFIPKPF-------RGFAFVTLSSAEAA 318

  Fly   191 TDLLKTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPRGGMRGGRGGYGGRGGYNNQ 247
            ..::......:.|..|.:..|.|:.||....|             ..||...||.|:
 Worm   319 ERIVSKGSLTVNGLSVGLSIAQPREENNQSVG-------------PDYGLPAGYRNR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 19/70 (27%)
RRM2_hnRNPD_like 137..211 CDD:240775 18/82 (22%)
tdp-1NP_001254189.1 RRM_SF 174..247 CDD:302621 20/73 (27%)
RRM_SF 262..339 CDD:302621 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.