DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and LOC1269848

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_061501486.1 Gene:LOC1269848 / 1269848 VectorBaseID:AGAMI1_013220 Length:379 Species:Anopheles gambiae


Alignment Length:62 Identity:21/62 - (33%)
Similarity:34/62 - (54%) Gaps:6/62 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTN-TEAIDKVSAAD 117
            |::||.|....::.|:...|||||.:.::.|..:|.     ||||:.|.: .:|.|.|.:.|
Mosquito    12 KVYVGNLGSSASKHEIESAFGKYGPLRNVWVARNPP-----GFAFVEFEDKRDAEDAVRSLD 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 20/61 (33%)
RRM2_hnRNPD_like 137..211 CDD:240775
LOC1269848XP_061501486.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.