DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and MSI2

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_005257071.1 Gene:MSI2 / 124540 HGNCID:18585 Length:346 Species:Homo sapiens


Alignment Length:348 Identity:119/348 - (34%)
Similarity:158/348 - (45%) Gaps:67/348 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQT 93
            ||..|.:||.|.|          :.|..|:|:|||||:|:...|||:|.|:|||....|..||.|
Human     4 NGSQGTSGSANDS----------QHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTT 58

  Fly    94 GRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPK---------KAKARHGKIFVGGLTTEISD 149
            .|||||.|:.|.:..::|||.....|.::||.:|||         |...|..|||||||:.....
Human    59 KRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVV 123

  Fly   150 EEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214
            |::|.||.|||.:.:..:.|||..::.:||.|:||::|.||..:.:....:|..|.|:.|:|.||
Human   124 EDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPK 188

  Fly   215 PENQMMGGMRGGPRG----------GMRGGRGGYGGRGGYNN--QWDGQGSYGGYGGGYG----G 263
             |.....|.||..||          ||        |..||.|  ...|:| |.|:...||    |
Human   189 -EVMFPPGTRGRARGLPYTMDAFMLGM--------GMLGYPNFVATYGRG-YPGFAPSYGYQFPG 243

  Fly   264 YGAGGYGDYYA-------GGYYNGY----DYGYDGYGYG------GGFEGNGYGGG-----GGGN 306
            :.|..||...|       |...|.|    ::|......|      |||.|....|.     |..:
Human   244 FPAAAYGPVAAAAVAAARGSVLNSYSAQPNFGAPASPAGSNPARPGGFPGANSPGPVADLYGPAS 308

  Fly   307 MGGGRGGPRGGGGPKGGGGFNGG 329
            ...|.|.......|:.|.||..|
Human   309 QDSGVGNYISAASPQPGSGFGHG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 33/70 (47%)
RRM2_hnRNPD_like 137..211 CDD:240775 29/73 (40%)
MSI2XP_005257071.1 RRM1_MSI2 17..109 CDD:410153 38/91 (42%)
PABP-1234 <35..343 CDD:130689 103/307 (34%)
RRM2_MSI 111..184 CDD:240769 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.