DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Gm21379

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001279986.1 Gene:Gm21379 / 100861987 MGIID:5434734 Length:565 Species:Mus musculus


Alignment Length:226 Identity:78/226 - (34%)
Similarity:114/226 - (50%) Gaps:35/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAENKQVDTEINGEDFTKDVTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSW 65
            :|..|..:||...|.|..|.|                     .||..||       |:|:||||.
Mouse     6 LAVEKDNETEQFREGFKIDAT---------------------KNQQDAS-------KMFIGGLSQ 42

  Fly    66 ETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKK 130
            |.:::.|.::..|:|||....:||||.||.||||.|::|.::..::||....:|.::.||::.|:
Mouse    43 EMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQVKDHKVDGKKIEFKR 107

  Fly   131 AKARHG-----KIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVV 190
            |||...     |||||||...:|:|:|:.|||.||.|..:|:|......:|:.|.||.:..|..|
Mouse   108 AKALESQFPNKKIFVGGLNPRLSEEKIRAYFGTFGQIEAIELPLCSDTRERRAFGFIKYMDENSV 172

  Fly   191 TDLLKTPKQKIAGKEVDVKRATPK--PENQM 219
            ..:|:.....|.....:||.|.||  |..|:
Mouse   173 RKVLENRYHFIGSSRCEVKMAYPKENPARQL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 28/70 (40%)
RRM2_hnRNPD_like 137..211 CDD:240775 28/73 (38%)
Gm21379NP_001279986.1 RRM_SF 35..108 CDD:302621 29/72 (40%)
RRM_SF 119..193 CDD:302621 28/73 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9500
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1055256at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43940
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.