DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and msi2

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_004911774.1 Gene:msi2 / 100038158 XenbaseID:XB-GENE-488852 Length:407 Species:Xenopus tropicalis


Alignment Length:391 Identity:119/391 - (30%)
Similarity:160/391 - (40%) Gaps:104/391 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SDNQSAASGQRDDDR----KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFI 102
            :|...|.||..:|.:    |:|:|||||:|:...|||:|.|:|||....|..||.|.|||||.|:
 Frog     3 ADGSQATSGSPNDSQHDPGKMFIGGLSWQTSPDSLRDYFNKFGEIRECMVMRDPTTKRSRGFGFV 67

  Fly   103 VFTNTEAIDKVSAADEHIINSKKVDPK---------KAKARHGKIFVGGLTTEISDEEIKTYFGQ 158
            .|.:..::|||.|...|.::||.:|||         |...|..|||||||:.....|::|.||.|
 Frog    68 TFADPASVDKVLAQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQ 132

  Fly   159 FGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGM 223
            ||.:.:..:.|||..::.:||.|:||:.|.||..:.:....:|..|.|:.|:|.|| |.....|.
 Frog   133 FGKVEDAMLMFDKTTNRHRGFGFVTFEIEDVVEKVCEIHFHEINNKMVECKKAQPK-EVMFPPGT 196

  Fly   224 RGGPRG------------GMRG--------GRGGYGGRGGYNNQWDGQGSYGGYG---------- 258
            ||..||            ||.|        |||..|....|:.|:.|..:...||          
 Frog   197 RGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYSYQFPGFPAAAAYGPVAAAAVAAA 261

  Fly   259 -----GGYGGYGAGG-------YGDYYAGG---------------------------------YY 278
                 ..||.|...|       :.||.:.|                                 ..
 Frog   262 RGSGIPDYGFYTTPGDQRATLSFADYGSMGPRTAQMLRSEHAASASNSPLHHLPSPDQFKSPAVL 326

  Fly   279 NGY----DYGYDGYGYG------GGFEGNGYGGG-----GGGNMGGGRGGPRGGGGPKGGGGFNG 328
            |.|    :||......|      |||.|....|.     |..:...|.|.......|:.|.||:.
 Frog   327 NSYSAQPNYGAPASPAGANPARPGGFPGANSPGPVADLYGTASQDSGVGNYISAASPQPGSGFSH 391

  Fly   329 G 329
            |
 Frog   392 G 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 34/70 (49%)
RRM2_hnRNPD_like 137..211 CDD:240775 29/73 (40%)
msi2XP_004911774.1 RRM <2..162 CDD:223796 66/158 (42%)
RRM1_MSI 23..97 CDD:241020 36/73 (49%)
RRM2_MSI 111..184 CDD:240769 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.