DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and msi2a

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_009303812.1 Gene:msi2a / 100002680 ZFINID:ZDB-GENE-030826-25 Length:407 Species:Danio rerio


Alignment Length:400 Identity:124/400 - (31%)
Similarity:167/400 - (41%) Gaps:114/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DAGAAGSTNGS-SDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTG 94
            :|.|:..|:|| :|:|       .|..|:|:|||||:|:...|||:|.|:|||....|..||.|.
Zfish     2 EADASQVTSGSLNDSQ-------HDPGKMFIGGLSWQTSPDSLRDYFCKFGEIRECMVMRDPTTK 59

  Fly    95 RSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPK---------KAKARHGKIFVGGLTTEISDE 150
            |||||.||.|.:..::|||.|...|.::||.:|||         |...|..|||||||:.....|
Zfish    60 RSRGFGFITFADVSSVDKVLAQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSASTVVE 124

  Fly   151 EIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKP 215
            ::|.||.|||.:.:..:.|||..::.:||.|:||::|.:|..:.:....:|..|.|:.|:|.|| 
Zfish   125 DVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDIVEKVCEIHFHEINNKMVECKKAQPK- 188

  Fly   216 ENQMMGGMRGGPRG------------GMRG--------GRGGYGGRGGYNNQWDG--QGSYG--- 255
            |.....|.||..|.            ||..        |||..|....|:.|:.|  ..:||   
Zfish   189 EVMFPPGTRGRARSLPYTMDAFMLGMGMLSYPNIVATYGRGYTGFSPSYSYQFPGFPATAYGPVA 253

  Fly   256 --------GYG------GGYGGY--GAG-GYGDYYAGGYYNG-----------YDYGYDGYGYG- 291
                    |.|      .||..|  .|| |:.||   |:|:|           .||...|...| 
Zfish   254 AAAVAAARGSGRATRGRSGYMAYPQNAGPGFPDY---GFYSGPGDQRAAPCSFADYATLGPHTGQ 315

  Fly   292 ----------------------------------GGFEGNGYGGG-----GGGNMGGGRGGPRGG 317
                                              |||.|....|.     |..:.....|.....
Zfish   316 MLQSEHVTSTCNSPSQHHPSPDHFKSSGANPPRPGGFPGANSPGPVADLYGPSSQDSAVGNYISA 380

  Fly   318 GGPKGGGGFN 327
            ..|:.|.|||
Zfish   381 ASPQPGSGFN 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 35/70 (50%)
RRM2_hnRNPD_like 137..211 CDD:240775 28/73 (38%)
msi2aXP_009303812.1 RRM <2..162 CDD:223796 70/166 (42%)
RRM1_MSI 23..97 CDD:241020 37/73 (51%)
RRM2_MSI 111..184 CDD:240769 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.