DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Cadm3

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001399743.1 Gene:Cadm3 / 94332 MGIID:2137858 Length:430 Species:Mus musculus


Alignment Length:559 Identity:111/559 - (19%)
Similarity:183/559 - (32%) Gaps:213/559 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LPLLML---------SGISQVCSTYVEQDELMQNLDRPVPL-----TTV---QGVLGRQAMLPCD 94
            ||||:|         :.:||  ..|.::.:|  .|..|.||     :||   ..:|..|     |
Mouse     7 LPLLLLLACSWAPGGANLSQ--DGYWQEQDL--ELGTPAPLEEALSSTVWSNPDLLASQ-----D 62

  Fly    95 ISPQERDDAVYMVLWFREGDGEPIYNFDVRGRQFGQARLWSSPTA----FGTRAHF--------S 147
            ..|...|:.|.       ..|..:....|:..:....: ||:|..    ||.:...        |
Mouse    63 SQPWTSDETVV-------AGGTVVLKCQVKDHEDSSLQ-WSNPAQQTLYFGEKRALRDNRIQLVS 119

  Fly   148 STTHPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVI--YGQNRHEKAGNVE 210
            ||.|...:.|.|:.:.|||.|.|.:  ...|.|..|..:||:..|.:|:|  |..:..||     
Mouse   120 STPHELSISISNVALADEGEYTCSI--FTMPVRTAKSLVTVLGIPQKPIITGYKSSLREK----- 177

  Fly   211 SFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCV 275
                                                                             
Mouse   178 ----------------------------------------------------------------- 177

  Fly   276 ASNTNLTPPNNRVVILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLK 340
                                                 .|..:.|:||||||.|.:||.||.::|.
Mouse   178 -------------------------------------ETATLNCQSSGSKPAAQLTWRKGDQELH 205

  Fly   341 -KLTKNFNEPDNQSLSI---LTFTPGREDDGKYLTCRAENQFIDGSAIEDKWRLIVHYQPTTTLK 401
             ..|:...:|:.::.::   ::|...|||||..:.|...::.:.|:......|:.|.|.||..::
Mouse   206 GDQTRIQEDPNGKTFTVSSSVSFQVTREDDGANIVCSVNHESLKGADRSTSQRIEVLYTPTAMIR 270

  Fly   402 IGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASA 466
                ..|...:||......|....||.|.:..|...|.|....::     .:.:|:...::::.:
Mouse   271 ----PEPAHPREGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMT-----QESALIFPFLNKSDS 326

  Fly   467 GDYTCLAVNSEG----------KGPSNPVTLRIRYAPICATDHEELLGA---------------- 505
            |.|.|.|.::.|          ..|| ||       |..::.:..::|.                
Mouse   327 GTYGCTATSNMGSYTAYFTLNVNDPS-PV-------PSSSSTYHAIIGGIVAFIVFLLLILLIFL 383

  Fly   506 ----LKHETLPLKCEV---DSSPPADSFQWTFNSSGEQT 537
                ::|:...|..|.   |.:|.||:.  ..|:.|.|:
Mouse   384 GHYLIRHKGTYLTHEAKGSDDAPDADTA--IINAEGGQS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 29/123 (24%)
Ig 210..281 CDD:472250 0/70 (0%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 24/78 (31%)
Ig strand C 329..333 CDD:409353 1/3 (33%)
Ig strand E 355..359 CDD:409353 0/6 (0%)
Ig strand F 369..374 CDD:409353 1/4 (25%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 15/77 (19%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 11/67 (16%)
Ig strand B 511..515 CDD:409353 1/3 (33%)
Ig strand C 525..529 CDD:409353 0/3 (0%)
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Cadm3NP_001399743.1 IgV_1_Necl-1 64..158 CDD:143290 24/103 (23%)
Ig strand A 64..67 CDD:143290 1/2 (50%)
FR1 65..83 CDD:143290 4/24 (17%)
Ig strand A' 68..74 CDD:143290 2/12 (17%)
Ig strand B 76..84 CDD:143290 1/7 (14%)
CDR1 84..89 CDD:143290 1/4 (25%)
FR2 90..97 CDD:143290 2/7 (29%)
Ig strand C 90..96 CDD:143290 1/6 (17%)
CDR2 98..109 CDD:143290 2/10 (20%)
Ig strand C' 100..104 CDD:143290 0/3 (0%)
Ig strand C' 106..109 CDD:143290 0/2 (0%)
FR3 110..145 CDD:143290 11/36 (31%)
Ig strand D 114..121 CDD:143290 1/6 (17%)
Ig strand E 124..130 CDD:143290 0/5 (0%)
Ig strand F 137..145 CDD:143290 4/9 (44%)
CDR3 146..149 CDD:143290 0/2 (0%)
Ig strand G 149..158 CDD:143290 2/8 (25%)
FR4 151..158 CDD:143290 1/6 (17%)
Ig 159..261 CDD:472250 31/208 (15%)
Ig strand B 180..184 CDD:409353 0/3 (0%)
Ig strand C 194..198 CDD:409353 1/3 (33%)
Ig strand E 224..228 CDD:409353 0/3 (0%)
Ig strand F 238..243 CDD:409353 1/4 (25%)
Ig strand G 254..257 CDD:409353 0/2 (0%)
IG_like 271..348 CDD:214653 16/81 (20%)
Ig strand B 282..286 CDD:409353 0/3 (0%)
Ig strand C 296..300 CDD:409353 0/3 (0%)
Ig strand E 314..318 CDD:409353 1/3 (33%)
Ig strand F 328..333 CDD:409353 2/4 (50%)
4.1m 386..401 CDD:128590 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.