DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and CEACAM21

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_016882919.1 Gene:CEACAM21 / 90273 HGNCID:28834 Length:302 Species:Homo sapiens


Alignment Length:239 Identity:51/239 - (21%)
Similarity:84/239 - (35%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 AMLPCDISPQER--------DDAVYMVLWFREGDGEP-----IYNFDVRGRQFGQARLWSSPTAF 140
            |..|.:::..|.        .:.:|...|::....||     .|..|...|..|        .|:
Human    48 ASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPG--------PAY 104

  Fly   141 GTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEK 205
            ..|...|.:   ..|...|:.:||.|.|..:|.:|||.......:|.|.....:|.|...:    
Human   105 SGRETISPS---GDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYESVAQPSIQASS---- 162

  Fly   206 AGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNS 270
                .:.:|...:||:|..:  ....:..|..:|..:..:  :|......||:...:..||....
Human   163 ----TTVTEKGSVVLTCHTN--NTGTSFQWIFNNQRLQVT--KRMKLSWFNHVLTIDPIRQEDAG 219

  Fly   271 RLMCVASN---TNLTPPNNRVVILDVNLKPIAVHILTKDRFVSA 311
            ...|..||   :|.:.|....|..|.|...|.:.:|.....|:|
Human   220 EYQCEVSNPVSSNRSDPLKLTVKSDDNTLGILIGVLVGSLLVAA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 25/111 (23%)
Ig 210..281 CDD:472250 14/73 (19%)
Ig strand B 218..222 CDD:409353 2/3 (67%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
CEACAM21XP_016882919.1 IgV_CEACAM_D1 45..149 CDD:409430 25/111 (23%)
FR1 46..64 CDD:409430 3/15 (20%)
Ig strand A 46..48 CDD:409430 51/239 (21%)
Ig strand A' 53..55 CDD:409430 0/1 (0%)
Ig strand B 58..65 CDD:409430 1/6 (17%)
CDR1 65..72 CDD:409430 0/6 (0%)
FR2 73..78 CDD:409430 1/4 (25%)
Ig strand C 73..77 CDD:409430 0/3 (0%)
CDR2 79..100 CDD:409430 5/20 (25%)
Ig strand C' 87..92 CDD:409430 0/4 (0%)
Ig strand C' 97..100 CDD:409430 1/2 (50%)
FR3 107..133 CDD:409430 8/28 (29%)
Ig strand D 107..112 CDD:409430 1/4 (25%)
Ig strand E 114..118 CDD:409430 1/3 (33%)
Ig strand F 128..133 CDD:409430 1/4 (25%)
CDR3 134..141 CDD:409430 3/6 (50%)
FR4 142..149 CDD:409430 1/6 (17%)
Ig strand G 142..148 CDD:409430 0/5 (0%)
IgI_hCEACAM_2_4_6_like 155..241 CDD:409402 18/97 (19%)
Ig strand A 155..159 CDD:409402 1/3 (33%)
Ig strand A' 162..166 CDD:409402 0/11 (0%)
Ig strand B 171..177 CDD:409402 3/5 (60%)
Ig strand C 184..189 CDD:409402 1/4 (25%)
Ig strand C' 191..194 CDD:409402 0/2 (0%)
Ig strand D 198..202 CDD:409402 1/3 (33%)
Ig strand E 205..210 CDD:409402 2/4 (50%)
Ig strand F 220..228 CDD:409402 2/7 (29%)
Ig strand G 232..241 CDD:409402 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.