| Sequence 1: | NP_001034052.2 | Gene: | side-IV / 41657 | FlyBaseID: | FBgn0038156 | Length: | 1001 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_016882919.1 | Gene: | CEACAM21 / 90273 | HGNCID: | 28834 | Length: | 302 | Species: | Homo sapiens |
| Alignment Length: | 239 | Identity: | 51/239 - (21%) |
|---|---|---|---|
| Similarity: | 84/239 - (35%) | Gaps: | 39/239 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 89 AMLPCDISPQER--------DDAVYMVLWFREGDGEP-----IYNFDVRGRQFGQARLWSSPTAF 140
Fly 141 GTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEK 205
Fly 206 AGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNS 270
Fly 271 RLMCVASN---TNLTPPNNRVVILDVNLKPIAVHILTKDRFVSA 311 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| side-IV | NP_001034052.2 | V-set | 79..188 | CDD:462230 | 25/111 (23%) |
| Ig | 210..281 | CDD:472250 | 14/73 (19%) | ||
| Ig strand B | 218..222 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 232..236 | CDD:409353 | 0/3 (0%) | ||
| Ig | <317..392 | CDD:472250 | |||
| Ig strand C | 329..333 | CDD:409353 | |||
| Ig strand E | 355..359 | CDD:409353 | |||
| Ig strand F | 369..374 | CDD:409353 | |||
| Ig strand G | 385..388 | CDD:409353 | |||
| Ig | 411..479 | CDD:472250 | |||
| Ig strand B | 417..421 | CDD:409353 | |||
| Ig strand C | 431..435 | CDD:409353 | |||
| Ig strand E | 454..458 | CDD:409353 | |||
| Ig strand F | 468..473 | CDD:409353 | |||
| Ig | 494..576 | CDD:472250 | |||
| Ig strand B | 511..515 | CDD:409353 | |||
| Ig strand C | 525..529 | CDD:409353 | |||
| Ig strand E | 551..555 | CDD:409353 | |||
| Ig strand F | 566..570 | CDD:409353 | |||
| fn3 | 593..675 | CDD:394996 | |||
| CEACAM21 | XP_016882919.1 | IgV_CEACAM_D1 | 45..149 | CDD:409430 | 25/111 (23%) |
| FR1 | 46..64 | CDD:409430 | 3/15 (20%) | ||
| Ig strand A | 46..48 | CDD:409430 | 51/239 (21%) | ||
| Ig strand A' | 53..55 | CDD:409430 | 0/1 (0%) | ||
| Ig strand B | 58..65 | CDD:409430 | 1/6 (17%) | ||
| CDR1 | 65..72 | CDD:409430 | 0/6 (0%) | ||
| FR2 | 73..78 | CDD:409430 | 1/4 (25%) | ||
| Ig strand C | 73..77 | CDD:409430 | 0/3 (0%) | ||
| CDR2 | 79..100 | CDD:409430 | 5/20 (25%) | ||
| Ig strand C' | 87..92 | CDD:409430 | 0/4 (0%) | ||
| Ig strand C' | 97..100 | CDD:409430 | 1/2 (50%) | ||
| FR3 | 107..133 | CDD:409430 | 8/28 (29%) | ||
| Ig strand D | 107..112 | CDD:409430 | 1/4 (25%) | ||
| Ig strand E | 114..118 | CDD:409430 | 1/3 (33%) | ||
| Ig strand F | 128..133 | CDD:409430 | 1/4 (25%) | ||
| CDR3 | 134..141 | CDD:409430 | 3/6 (50%) | ||
| FR4 | 142..149 | CDD:409430 | 1/6 (17%) | ||
| Ig strand G | 142..148 | CDD:409430 | 0/5 (0%) | ||
| IgI_hCEACAM_2_4_6_like | 155..241 | CDD:409402 | 18/97 (19%) | ||
| Ig strand A | 155..159 | CDD:409402 | 1/3 (33%) | ||
| Ig strand A' | 162..166 | CDD:409402 | 0/11 (0%) | ||
| Ig strand B | 171..177 | CDD:409402 | 3/5 (60%) | ||
| Ig strand C | 184..189 | CDD:409402 | 1/4 (25%) | ||
| Ig strand C' | 191..194 | CDD:409402 | 0/2 (0%) | ||
| Ig strand D | 198..202 | CDD:409402 | 1/3 (33%) | ||
| Ig strand E | 205..210 | CDD:409402 | 2/4 (50%) | ||
| Ig strand F | 220..228 | CDD:409402 | 2/7 (29%) | ||
| Ig strand G | 232..241 | CDD:409402 | 2/8 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||