DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and SIGLEC12

DIOPT Version :9

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_443729.1 Gene:SIGLEC12 / 89858 HGNCID:15482 Length:595 Species:Homo sapiens


Alignment Length:501 Identity:120/501 - (23%)
Similarity:179/501 - (35%) Gaps:120/501 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDIS-PQE---RDDAVY 105
            ||||.|:...:..     .||.:.:..:.:.|   |||.  |....:.|..| ||.   ..|.|:
Human     6 LLLPPLLCGRVGA-----KEQKDYLLTMQKSV---TVQE--GLCVSVLCSFSYPQNGWTASDPVH 60

  Fly   106 MVLWFREGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHP----AQLKIDNIRIEDEG 166
             ..|||.|| ....|..|......:|      ....||..|.....|    ..|.|.:.|..|.|
Human    61 -GYWFRAGD-HVSRNIPVATNNPARA------VQEETRDRFHLLGDPQNKDCTLSIRDTRESDAG 117

  Fly   167 VYRCRVDFRNSPTRNLKIN-LTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLSCEVSGGRPR 230
            .|...|: |.:...|.|.: |:|.|...:.:: .:.|.|...:| :..||..:.:.|.|.    .
Human   118 TYVFCVE-RGNMKWNYKYDQLSVNVTASQDLL-SRYRLEVPESV-TVQEGLCVSVPCSVL----Y 175

  Fly   231 PNVTWYLDNTAIDESFEQ-------------RPDGKT--INHLSYPNVGRQHLNSRLMCVASNTN 280
            |:..|...:......|::             .|.||.  ..|..:..:|....|:   |..|..:
Human   176 PHYNWTASSPVYGSWFKEGADIPWDIPVATNTPSGKVQEDTHGRFLLLGDPQTNN---CSLSIRD 237

  Fly   281 LTPPNNRVVILDVN---------LKPIAVHI--LTKDRFVSADRTYDVECKSSG-------SKP- 326
            ....::......|.         ...::||:  ||.....|...|.:     ||       |.| 
Human   238 ARKGDSGKYYFQVERGSRKWNYIYDKLSVHVTALTHMPTFSIPGTLE-----SGHPRNLTCSVPW 297

  Fly   327 ------PALITWWKGSKQLKKLTKNFNEPDNQSLSILTFTPGREDDGKYLTCRAENQFIDGSAI- 384
                  |..|||...|  :..|     :|.....|:|:..|..:|.|..|||:..   :.|:.: 
Human   298 ACEQGTPPTITWMGAS--VSSL-----DPTITRSSMLSLIPQPQDHGTSLTCQVT---LPGAGVT 352

  Fly   385 -EDKWRLIVHYQP--------------TTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSW 434
             ....||.:.|.|              :|||:.||:|:   :.||...:..|.|.:|| |.::||
Human   353 MTRAVRLNISYPPQNLTMTVFQGDGTASTTLRNGSALS---VLEGQSLHLVCAVDSNP-PARLSW 413

  Fly   435 FHNGKELQHNISA--GVILSDQSLVLQSVSRASAGDYTCLAVNSEG 478
            ......|..:.|:  ||      |.|..|.....|::||.|.|..|
Human   414 TWGSLTLSPSQSSNLGV------LELPRVHVKDEGEFTCRAQNPLG 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:284989 33/117 (28%)
IG_like 80..188 CDD:214653 33/116 (28%)
Ig 210..281 CDD:299845 15/85 (18%)
Ig 319..392 CDD:299845 22/88 (25%)
IG_like 319..383 CDD:214653 20/77 (26%)
IG_like 412..489 CDD:214653 22/69 (32%)
IGc2 413..478 CDD:197706 21/66 (32%)
Ig_3 509..572 CDD:290638
fn3 593..675 CDD:278470
SIGLEC12NP_443729.1 Ig 24..142 CDD:325142 35/131 (27%)
Ig 151..269 CDD:325142 21/125 (17%)
Ig 232..345 CDD:325142 27/124 (22%)
IG_like 389..462 CDD:214653 23/75 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 512..560
ITIM motif 563..568
SLAM-like motif 586..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.