| Sequence 1: | NP_001034052.2 | Gene: | side-IV / 41657 | FlyBaseID: | FBgn0038156 | Length: | 1001 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001129388.1 | Gene: | Skint1 / 689801 | RGDID: | 1587579 | Length: | 377 | Species: | Rattus norvegicus |
| Alignment Length: | 187 | Identity: | 45/187 - (24%) |
|---|---|---|---|
| Similarity: | 68/187 - (36%) | Gaps: | 54/187 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 67 ELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDAVYM-VLWFREGDGEPIYNFDVRGRQFGQ 130
Fly 131 --------ARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIEDEGVYRC---RVDFRNSPTRNLK- 183
Fly 184 --INLTV---IVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLSCEVSGGRPRPNVTW 235 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| side-IV | NP_001034052.2 | V-set | 79..188 | CDD:462230 | 31/123 (25%) |
| Ig | 210..281 | CDD:472250 | 7/26 (27%) | ||
| Ig strand B | 218..222 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 232..236 | CDD:409353 | 1/4 (25%) | ||
| Ig | <317..392 | CDD:472250 | |||
| Ig strand C | 329..333 | CDD:409353 | |||
| Ig strand E | 355..359 | CDD:409353 | |||
| Ig strand F | 369..374 | CDD:409353 | |||
| Ig strand G | 385..388 | CDD:409353 | |||
| Ig | 411..479 | CDD:472250 | |||
| Ig strand B | 417..421 | CDD:409353 | |||
| Ig strand C | 431..435 | CDD:409353 | |||
| Ig strand E | 454..458 | CDD:409353 | |||
| Ig strand F | 468..473 | CDD:409353 | |||
| Ig | 494..576 | CDD:472250 | |||
| Ig strand B | 511..515 | CDD:409353 | |||
| Ig strand C | 525..529 | CDD:409353 | |||
| Ig strand E | 551..555 | CDD:409353 | |||
| Ig strand F | 566..570 | CDD:409353 | |||
| fn3 | 593..675 | CDD:394996 | |||
| Skint1 | NP_001129388.1 | IGv domain | 27..141 | 31/128 (24%) | |
| IgV_MOG_like | 28..141 | CDD:409378 | 30/127 (24%) | ||
| FR1 | 28..51 | CDD:409378 | 7/25 (28%) | ||
| Ig strand A | 29..33 | CDD:409378 | 0/3 (0%) | ||
| Ig strand A' | 36..40 | CDD:409378 | 2/6 (33%) | ||
| Ig strand B | 43..51 | CDD:409378 | 2/7 (29%) | ||
| CDR1 | 52..60 | CDD:409378 | 3/9 (33%) | ||
| Ig strand C | 60..65 | CDD:409378 | 1/4 (25%) | ||
| FR2 | 61..65 | CDD:409378 | 0/3 (0%) | ||
| CDR2 | 66..84 | CDD:409378 | 3/17 (18%) | ||
| Ig strand C' | 70..78 | CDD:409378 | 2/7 (29%) | ||
| Ig strand C' | 79..82 | CDD:409378 | 0/2 (0%) | ||
| FR3 | 86..126 | CDD:409378 | 9/49 (18%) | ||
| Ig strand D | 93..98 | CDD:409378 | 1/4 (25%) | ||
| Ig strand E | 104..112 | CDD:409378 | 3/17 (18%) | ||
| Ig strand F | 119..127 | CDD:409378 | 3/7 (43%) | ||
| CDR3 | 127..129 | CDD:409378 | 0/1 (0%) | ||
| Ig strand G | 129..141 | CDD:409378 | 3/11 (27%) | ||
| FR4 | 130..141 | CDD:409378 | 2/10 (20%) | ||
| IGc domain | 142..228 | 13/56 (23%) | |||
| transmembrane domain 1 | 247..269 | ||||
| transmembrane domain 2 | 282..304 | ||||
| transmembrane domain 3 | 326..348 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||