DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Skint8

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_008762179.2 Gene:Skint8 / 689792 RGDID:1588696 Length:362 Species:Rattus norvegicus


Alignment Length:190 Identity:48/190 - (25%)
Similarity:75/190 - (39%) Gaps:45/190 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PLTTVQGVLGRQAMLPCDISPQERDDAVYM-VLWFREGDGEPIYNFDVRGRQFGQARLWSSPTAF 140
            |...|...:|.||.|.|.:.|.:  ...|| |.|||.|..:|:|.:  ||   |.:....:...:
  Rat    33 PTRHVLARVGGQAELSCQVIPPQ--SVGYMEVRWFRSGHSQPVYLY--RG---GHSMSGEAAPEY 90

  Fly   141 GTRAHFSSTT---HPAQLKIDNIRIEDEGVYRCRVDFRNS---PTRNLKINLTVIVPPDRPVIYG 199
            ..|..|....   ....|:|.||.|.|:|.|||  .|.:|   ...::.:|:|.:         |
  Rat    91 ANRTQFVKEAIGEGKVTLRIHNISILDDGPYRC--SFNDSGFIDVASMNLNVTAV---------G 144

  Fly   200 QNR--HEKAGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINH 257
            ...  |.:|      .:.:.:::.|...|..|:|.:.|...|            |:|:.|
  Rat   145 LETEIHVQA------PDADGVIVECNSGGWFPKPQMEWRDSN------------GETLRH 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 34/115 (30%)
Ig 210..281 CDD:472250 9/48 (19%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Skint8XP_008762179.2 IgV_MOG_like 30..141 CDD:409378 35/116 (30%)
FR1 30..51 CDD:409378 7/17 (41%)
Ig strand A 30..33 CDD:409378 48/190 (25%)
Ig strand A' 36..40 CDD:409378 1/3 (33%)
Ig strand B 43..51 CDD:409378 4/7 (57%)
CDR1 52..60 CDD:409378 1/9 (11%)
Ig strand C 60..65 CDD:409378 2/4 (50%)
FR2 61..65 CDD:409378 1/3 (33%)
CDR2 66..84 CDD:409378 7/22 (32%)
Ig strand C' 70..78 CDD:409378 2/9 (22%)
Ig strand C' 79..82 CDD:409378 1/2 (50%)
FR3 86..126 CDD:409378 12/41 (29%)
Ig strand D 93..98 CDD:409378 2/4 (50%)
Ig strand E 104..112 CDD:409378 2/7 (29%)
Ig strand F 119..127 CDD:409378 5/9 (56%)
CDR3 127..129 CDD:409378 0/1 (0%)
Ig strand G 129..141 CDD:409378 1/11 (9%)
FR4 130..141 CDD:409378 1/10 (10%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.