DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Btnl4

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001159826.1 Gene:Btnl4 / 686977 RGDID:1624210 Length:538 Species:Rattus norvegicus


Alignment Length:238 Identity:58/238 - (24%)
Similarity:94/238 - (39%) Gaps:46/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EPCCRKKPTAPHPFPSPNVWRQLLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGR 87
            |.||:         ||      ||..:|.|..::|:.|....:|.|:.....|:..|     ||.
  Rat     2 ENCCK---------PS------LLFHILCLLVLTQMTSLVTAKDFLVFGPSDPIVAT-----LGG 46

  Fly    88 QAMLPCDISPQERDDAVYMVLWFREGDGEPIYNF-DVRGRQFGQARLWSSPTAFGTRAHFSSTTH 151
            :|:|||.:.|....:.:..:.|||....|.::.: |...::.||...:|..|:. .:..|..  .
  Rat    47 EAILPCSVFPVMSVENMEELRWFRTRFSEAVFVYRDQEEQKEGQLPGYSQRTSL-VKDQFHE--G 108

  Fly   152 PAQLKIDNIRIEDEGVYRCRV---DFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFS 213
            .|.::|.|::..|.|:|.|..   .|.......||:.....||.    :|          ::...
  Rat   109 KAAVRIQNVQESDSGIYVCHFKQGHFHEEAILELKVAAMGSVPE----VY----------IKGPE 159

  Fly   214 EGNDIVLSCEVSGGRPRPNVTWY----LDNTAIDESFEQRPDG 252
            ||. :.:.|..||..|.|.|.|.    .|..|..|:..:..:|
  Rat   160 EGG-VCVVCMTSGWYPEPQVHWRDSRGEDLPASSETLHEDAEG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 28/112 (25%)
Ig 210..281 CDD:472250 13/47 (28%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 1/3 (33%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Btnl4NP_001159826.1 IgV_MOG_like 31..145 CDD:409378 30/121 (25%)
FR1 31..54 CDD:409378 9/27 (33%)
Ig strand A 32..36 CDD:409378 1/3 (33%)
Ig strand A' 39..43 CDD:409378 1/3 (33%)
Ig strand B 46..54 CDD:409378 4/7 (57%)
CDR1 55..63 CDD:409378 1/7 (14%)
Ig strand C 63..69 CDD:409378 0/5 (0%)
FR2 64..69 CDD:409378 0/4 (0%)
CDR2 70..88 CDD:409378 3/17 (18%)
Ig strand C' 74..82 CDD:409378 1/7 (14%)
Ig strand C' 83..86 CDD:409378 0/2 (0%)
FR3 90..130 CDD:409378 11/42 (26%)
Ig strand D 97..102 CDD:409378 1/5 (20%)
Ig strand E 108..116 CDD:409378 2/7 (29%)
Ig strand F 123..131 CDD:409378 3/7 (43%)
CDR3 131..133 CDD:409378 0/1 (0%)
Ig strand G 133..145 CDD:409378 3/11 (27%)
FR4 134..145 CDD:409378 3/10 (30%)
Ig 148..232 CDD:472250 16/69 (23%)
SPRY_PRY_C-I_1 343..496 CDD:293968
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.