DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Skint1

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001096132.1 Gene:Skint1 / 639781 MGIID:3649627 Length:364 Species:Mus musculus


Alignment Length:308 Identity:71/308 - (23%)
Similarity:113/308 - (36%) Gaps:91/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDAVYM-VLWFREGDGEPIYNFDVRGRQFGQ- 130
            ::..|:.||..:     ||....|.|.:||.::  |.:| :.|||....||::.:......||: 
Mouse    29 IVNGLEGPVLAS-----LGGNLELSCQLSPPQQ--AQHMEIRWFRNLYTEPVHLYRDGKDMFGEI 86

  Fly   131 -------ARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRV---DFRNSPTRNLK-- 183
                   ..|.......|          ...|:|.|:.::|:|.|.|..   ||.......:|  
Mouse    87 ISKYVERTELLKDGIGEG----------KVTLRIFNVTVDDDGSYHCVFKDGDFYEEHITEVKIT 141

  Fly   184 -INLTV---IVPPD---------------RPVIYGQNRHEKAGNV-----ESFSEGNDIVLSCEV 224
             |||.|   :.||:               ||::..::|.   |.|     :|.|:|.|.:.:.::
Mouse   142 AINLQVQIHVHPPNTKGVIVECHSGGWFPRPLMQWRDRR---GEVIPAASKSHSQGRDKLFNMKI 203

  Fly   225 SGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVASNTNLTPPNNRV- 288
            |              ..|.|||.|    |.|..|..|..|::...|.::..|..:     .||: 
Mouse   204 S--------------LLISESFFQ----KVICCLQNPLTGQEERTSVILSDAFFS-----WNRIW 245

  Fly   289 -VILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKG 335
             :||.:.|..:.|.|......:..:...   ||.....|     |.||
Mouse   246 KMILGIILSMMVVSIFVFSCLLHHEHKV---CKWKWDAP-----WIKG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 30/123 (24%)
Ig 210..281 CDD:472250 17/70 (24%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 6/19 (32%)
Ig strand C 329..333 CDD:409353 0/3 (0%)
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Skint1NP_001096132.1 IGv domain 27..141 30/128 (23%)
IgV_MOG_like 28..141 CDD:409378 30/128 (23%)
FR1 28..51 CDD:409378 7/26 (27%)
Ig strand A 29..33 CDD:409378 0/3 (0%)
Ig strand A' 36..40 CDD:409378 2/3 (67%)
Ig strand B 43..51 CDD:409378 2/7 (29%)
CDR1 52..60 CDD:409378 3/9 (33%)
Ig strand C 60..65 CDD:409378 1/4 (25%)
FR2 61..65 CDD:409378 0/3 (0%)
CDR2 66..84 CDD:409378 3/17 (18%)
Ig strand C' 70..78 CDD:409378 2/7 (29%)
Ig strand C' 79..82 CDD:409378 0/2 (0%)
FR3 86..126 CDD:409378 9/49 (18%)
Ig strand D 93..98 CDD:409378 1/4 (25%)
Ig strand E 104..112 CDD:409378 3/17 (18%)
Ig strand F 119..127 CDD:409378 3/7 (43%)
CDR3 127..129 CDD:409378 0/1 (0%)
Ig strand G 129..141 CDD:409378 3/11 (27%)
FR4 130..141 CDD:409378 2/10 (20%)
IGc domain 142..228 26/106 (25%)
transmembrane domain 1 247..269 5/21 (24%)
transmembrane domain 2 282..304 3/4 (75%)
transmembrane domain 3 326..348
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.