DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Skint8

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001093936.2 Gene:Skint8 / 639774 MGIID:3651523 Length:398 Species:Mus musculus


Alignment Length:156 Identity:42/156 - (26%)
Similarity:64/156 - (41%) Gaps:25/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LGRQAMLPCDISPQERDDAVYM-VLWFREGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSS 148
            :|.||.|.|.:.|..  ..::| |.|||.|..:|:|.:  ||   |......:...:..|..|..
Mouse    41 VGGQAELSCQVIPPH--SVMHMEVRWFRSGHSQPVYLY--RG---GHKMSEEAAPEYANRTEFVK 98

  Fly   149 TT---HPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNLKI-NLTVIVPPDRPVIYGQNRHEKAGNV 209
            ..   ....|:|.||.|.|:|.|:|  .|.:|...::.| ||.|........|:.|         
Mouse    99 EAIGEGKVSLRIYNINILDDGPYQC--SFNDSGFIDVAIMNLNVTAVGLETEIHVQ--------- 152

  Fly   210 ESFSEGNDIVLSCEVSGGRPRPNVTW 235
              ..:.:.:::.|...|..|||.:.|
Mouse   153 --APDADGVMVECNTGGWFPRPQMEW 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 33/107 (31%)
Ig 210..281 CDD:472250 6/26 (23%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 1/4 (25%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Skint8NP_001093936.2 IgV_MOG_like 29..141 CDD:409378 33/108 (31%)
FR1 29..51 CDD:409378 5/9 (56%)
Ig strand A 29..33 CDD:409378
Ig strand A' 36..40 CDD:409378
Ig strand B 43..51 CDD:409378 4/7 (57%)
CDR1 52..60 CDD:409378 1/9 (11%)
Ig strand C 60..65 CDD:409378 2/4 (50%)
FR2 61..65 CDD:409378 1/3 (33%)
CDR2 66..84 CDD:409378 7/22 (32%)
Ig strand C' 70..78 CDD:409378 2/9 (22%)
Ig strand C' 79..82 CDD:409378 1/2 (50%)
FR3 86..126 CDD:409378 11/41 (27%)
Ig strand D 93..98 CDD:409378 2/4 (50%)
Ig strand E 104..112 CDD:409378 2/7 (29%)
Ig strand F 119..127 CDD:409378 4/9 (44%)
CDR3 127..129 CDD:409378 0/1 (0%)
Ig strand G 129..141 CDD:409378 3/11 (27%)
FR4 130..141 CDD:409378 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.