DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Nectin3

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_067470.1 Gene:Nectin3 / 58998 MGIID:1930171 Length:549 Species:Mus musculus


Alignment Length:528 Identity:119/528 - (22%)
Similarity:184/528 - (34%) Gaps:133/528 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PFPSPNVWRQLLLPLLMLSGISQVC-----STYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCD 94
            |.|:|.....||:|||:   .|::|     |..||..              |..|.|:...|.|.
Mouse    32 PAPTPPPLLLLLIPLLL---FSRLCGALAGSIIVEPH--------------VTAVWGKNVSLKCL 79

  Fly    95 ISPQERDDAVYMVLWFR-EGDG-------EPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSS-TT 150
            |   |.::.:..:.|.: .|..       .|.|.|.|:|...|             |..|.: :.
Mouse    80 I---EVNETITQISWEKIHGKSTQTVAVHHPQYGFSVQGDYQG-------------RVLFKNYSL 128

  Fly   151 HPAQLKIDNIRIEDEGVYRCR-VDFRNSPTRNLK--INLTVIVPPDRPVIYGQNRHEKAGNVESF 212
            :.|.:.:.||...|.|.|.|: |.|   |..|.:  ..:||:|.|...:|.|.:.....||    
Mouse   129 NDATITLHNIGFSDSGKYICKAVTF---PLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGN---- 186

  Fly   213 SEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLS----YPNVGRQHLNSRLM 273
               ..:...|..:.|:|...:.|..|...::.|....|: :|...:|    :|.  |.....|:.
Mouse   187 ---ETVAAVCVAATGKPVAQIDWEGDLGEMESSTTSFPN-ETATIVSQYKLFPT--RFARGRRIT 245

  Fly   274 CVASNTNLTPPNNRVVILDVNLKP-IAVHILTKDRFVSADRTYDVECKSSGSKPPALITW----- 332
            ||..:..|........|||:...| ::|.....:.||.. :..:::|.:..:.||....|     
Mouse   246 CVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNWFVGR-KGVNLKCNADANPPPFKSVWSRLDG 309

  Fly   333 -WKGSKQLKKLTKNFNEPDNQSLSILTFTPGREDDGKYLTCRAENQFIDGSAIEDKWRLIVHYQP 396
             |.........|.:|..|...:.|           |.|: |:..|..  |...:.|...|.....
Mouse   310 QWPDGLLASDNTLHFVHPLTVNYS-----------GVYV-CKVSNSL--GQRSDQKVIYISDPPT 360

  Fly   397 TTTLK--IGSSLNPDDIKEGDDAYFECIVLANPK-PYKMSWFHNGK-ELQHNISAGVILSDQSLV 457
            ||||:  :....:|.|:::        |...:.| |:.:|.....| :....|.|.|:.....||
Mouse   361 TTTLQPTVQWHSSPADVQD--------IATEHKKLPFPLSTLATLKDDTIGTIIASVVGGALFLV 417

  Fly   458 LQSV---------SRASAGDYTCLAVNSEGKGPSNPVTLRIRYAPICATDHEELLGALKHETLPL 513
            |.|:         .|...|||  .|.|               |.|......|..:..|..:    
Mouse   418 LVSILAGVFCYRRRRTFRGDY--FAKN---------------YIPPSDMQKESQIDVLHQD---- 461

  Fly   514 KCEVDSSP 521
              |:||.|
Mouse   462 --ELDSYP 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 28/120 (23%)
Ig 210..281 CDD:472250 14/74 (19%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 15/80 (19%)
Ig strand C 329..333 CDD:409353 1/9 (11%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 18/78 (23%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 1/3 (33%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 6/28 (21%)
Ig strand B 511..515 CDD:409353 0/3 (0%)
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Nectin3NP_067470.1 IgV_1_Nectin-3_like 58..167 CDD:409470 32/141 (23%)
FR1 58..81 CDD:409470 9/39 (23%)
Ig strand A 58..62 CDD:409470 1/3 (33%)
Ig strand A' 64..68 CDD:409470 1/17 (6%)
Ig strand B 73..81 CDD:409470 3/10 (30%)
CDR1 82..86 CDD:409470 0/3 (0%)
FR2 87..93 CDD:409470 1/5 (20%)
Ig strand C 88..93 CDD:409470 1/4 (25%)
CDR2 94..113 CDD:409470 4/18 (22%)
Ig strand C' 103..108 CDD:409470 0/4 (0%)
Ig strand C' 110..114 CDD:409470 1/3 (33%)
FR3 114..152 CDD:409470 11/50 (22%)
Ig strand D 121..125 CDD:409470 1/3 (33%)
Ig strand E 130..137 CDD:409470 1/6 (17%)
Ig strand F 144..152 CDD:409470 3/7 (43%)
CDR3 153..156 CDD:409470 2/5 (40%)
Ig strand G 156..166 CDD:409470 1/9 (11%)
FR4 157..167 CDD:409470 2/9 (22%)
IgC1_2_Nectin-3-4_like 170..265 CDD:409501 22/104 (21%)
Ig strand A 170..176 CDD:409501 1/5 (20%)
Ig strand B 189..196 CDD:409501 1/6 (17%)
Ig strand C 201..207 CDD:409501 0/5 (0%)
Ig strand C' 209..211 CDD:409501 1/1 (100%)
Ig strand D 213..220 CDD:409501 1/6 (17%)
Ig strand E 225..233 CDD:409501 1/7 (14%)
Ig strand F 243..250 CDD:409501 3/6 (50%)
Ig strand G 256..262 CDD:409501 0/5 (0%)
Ig 269..355 CDD:472250 19/100 (19%)
Ig strand B 287..291 CDD:409353 0/3 (0%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 320..325 CDD:409353 1/4 (25%)
Ig strand F 335..340 CDD:409353 2/5 (40%)
Ig strand G 350..353 CDD:409353 1/2 (50%)
TM_EGFR-like 402..432 CDD:213052 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.