DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and CADM3

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_024304528.1 Gene:CADM3 / 57863 HGNCID:17601 Length:481 Species:Homo sapiens


Alignment Length:548 Identity:104/548 - (18%)
Similarity:175/548 - (31%) Gaps:225/548 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PNVWRQLLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDA 103
            |||.:|:.|           |   |.:|......|..|       |.|...:|.|.:...| |.:
Human   100 PNVEQQICL-----------C---VFRDSQPWTSDETV-------VAGGTVVLKCQVKDHE-DSS 142

  Fly   104 VYMVLWFREGDGEPIYNFDVRGRQFGQARLWSSPTA----FGTRAHF--------SSTTHPAQLK 156
            :.                            ||:|..    ||.:...        :||.|...:.
Human   143 LQ----------------------------WSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSIS 179

  Fly   157 IDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLS 221
            |.|:.:.|||.|.|.:  ...|.|..|..:||:..|.:|:|.|.                     
Human   180 ISNVALADEGEYTCSI--FTMPVRTAKSLVTVLGIPQKPIITGY--------------------- 221

  Fly   222 CEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVASNTNLTPPNN 286
                                  :|..:..|..|:|                              
Human   222 ----------------------KSSLREKDTATLN------------------------------ 234

  Fly   287 RVVILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLK-KLTKNFNEPD 350
                                            |:||||||.|.:||.||.::|. :.|:...:|:
Human   235 --------------------------------CQSSGSKPAARLTWRKGDQELHGEPTRIQEDPN 267

  Fly   351 NQSLSI---LTFTPGREDDGKYLTCRAENQFIDGSAIEDKWRLIVHYQPTTTLKIGSSLNPDDIK 412
            .::.::   :||...|||||..:.|...::.:.|:......|:.|.|.||..::    .:|...:
Human   268 GKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIR----PDPPHPR 328

  Fly   413 EGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTCLAVNSE 477
            ||......|....||.|.:..|     |.:.::....:..:.:|:...::::.:|.|.|.|.::.
Human   329 EGQKLLLHCEGRGNPVPQQYLW-----EKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNM 388

  Fly   478 G----------KGPSNPVTLRIRYAPICATDHEELLGA--------------------LKHETLP 512
            |          ..|| ||       |..::.:..::|.                    ::|:...
Human   389 GSYKAYYTLNVNDPS-PV-------PSSSSTYHAIIGGIVAFIVFLLLIMLIFLGHYLIRHKGTY 445

  Fly   513 LKCEV---DSSPPADSFQWTFNSSGEQT 537
            |..|.   |.:|.||:.  ..|:.|.|:
Human   446 LTHEAKGSDDAPDADTA--IINAEGGQS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 24/120 (20%)
Ig 210..281 CDD:472250 4/70 (6%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 25/78 (32%)
Ig strand C 329..333 CDD:409353 1/3 (33%)
Ig strand E 355..359 CDD:409353 0/6 (0%)
Ig strand F 369..374 CDD:409353 1/4 (25%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 14/77 (18%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 11/67 (16%)
Ig strand B 511..515 CDD:409353 1/3 (33%)
Ig strand C 525..529 CDD:409353 0/3 (0%)
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
CADM3XP_024304528.1 IgV_1_Necl-1 115..209 CDD:143290 26/131 (20%)
Ig strand A 115..118 CDD:143290 0/2 (0%)
FR1 116..134 CDD:143290 5/24 (21%)
Ig strand A' 119..125 CDD:143290 2/12 (17%)
Ig strand B 127..135 CDD:143290 2/7 (29%)
CDR1 135..140 CDD:143290 1/5 (20%)
FR2 141..148 CDD:143290 2/34 (6%)
Ig strand C 141..147 CDD:143290 1/33 (3%)
CDR2 149..160 CDD:143290 2/10 (20%)
Ig strand C' 151..155 CDD:143290 0/3 (0%)
Ig strand C' 157..160 CDD:143290 0/2 (0%)
FR3 161..196 CDD:143290 10/36 (28%)
Ig strand D 165..172 CDD:143290 0/6 (0%)
Ig strand E 175..181 CDD:143290 0/5 (0%)
Ig strand F 188..196 CDD:143290 4/9 (44%)
CDR3 197..200 CDD:143290 0/2 (0%)
Ig strand G 200..209 CDD:143290 2/8 (25%)
FR4 202..209 CDD:143290 1/6 (17%)
IgI_2_Necl-1 210..312 CDD:409502 33/206 (16%)
Ig strand A 210..213 CDD:409502 0/2 (0%)
Ig strand A' 216..220 CDD:409502 2/3 (67%)
Ig strand B 229..239 CDD:409502 5/71 (7%)
Ig strand C 242..251 CDD:409502 4/8 (50%)
Ig strand C' 252..255 CDD:409502 0/2 (0%)
Ig strand D 258..265 CDD:409502 1/6 (17%)
Ig strand E 270..280 CDD:409502 1/9 (11%)
Ig strand F 288..296 CDD:409502 1/7 (14%)
Ig strand G 304..311 CDD:409502 1/6 (17%)
IG_like 328..399 CDD:214653 14/75 (19%)
Ig strand B 333..337 CDD:409504 0/3 (0%)
Ig strand C 347..351 CDD:409504 1/8 (13%)
Ig strand E 365..369 CDD:409504 1/3 (33%)
Ig strand F 379..384 CDD:409504 2/4 (50%)
4.1m 437..452 CDD:128590 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.