DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and sc:d0202

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_068073530.1 Gene:sc:d0202 / 569842 ZFINID:ZDB-GENE-080226-9 Length:302 Species:Danio rerio


Alignment Length:265 Identity:69/265 - (26%)
Similarity:100/265 - (37%) Gaps:61/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 VTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQH--------LNSRLMCVASNTNLTPPNNRVV 289
            :||.:         .:..|........|.|..:|.        :.|..:|.:|:|. ||  :.|.
Zfish    74 ITWRV---------SELTDWDIYTPFCYINYDKQQCVVALPVTVYSIRVCESSSTE-TP--DSVS 126

  Fly   290 ILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALIT--WWKGSKQLKK--LTKNFNEPD 350
            |..|||..|..::            |::.|......|...:|  |:||...:.:  .|.....|.
Zfish   127 ISTVNLTMIEGNL------------YELLCDVHNVAPVQKLTVNWYKGETLVDQTNFTDTTKSPV 179

  Fly   351 NQSLSILTFTPGREDDGKYLTCRAENQFID------GSAIEDKWRLIVHYQPTTTLKIGSSLNPD 409
            |:: |.|...|.|.|||....|.||....|      .:.....:.:.|||:|.      .|.:.:
Zfish   180 NKT-SKLLIRPDRADDGAQYRCEAELNLGDEGPQHPPTVTSKSFSIKVHYKPK------HSRSTE 237

  Fly   410 DIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTCLAV 474
            .|.:.||....|.|.|||... .:|  :.|.|...||:.||.|         |..|.|:|||.|.
Zfish   238 KISQSDDVSLNCTVKANPAAV-YTW--HSKHLIEKISSSVIQS---------STLSPGNYTCTAA 290

  Fly   475 NSEGK 479
            |..|:
Zfish   291 NYLGE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230
Ig 210..281 CDD:472250 10/55 (18%)
Ig strand B 218..222 CDD:409353
Ig strand C 232..236 CDD:409353 1/2 (50%)
Ig <317..392 CDD:472250 20/84 (24%)
Ig strand C 329..333 CDD:409353 1/5 (20%)
Ig strand E 355..359 CDD:409353 2/3 (67%)
Ig strand F 369..374 CDD:409353 1/4 (25%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 24/67 (36%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 0/3 (0%)
Ig strand F 468..473 CDD:409353 3/4 (75%)
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
sc:d0202XP_068073530.1 Ig 122..203 CDD:472250 25/95 (26%)
Ig strand B 140..144 CDD:409353 1/3 (33%)
Ig strand C 154..160 CDD:409353 1/5 (20%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig_2 229..302 CDD:464026 27/85 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.