DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and PSG7

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_002774.2 Gene:PSG7 / 5676 HGNCID:9524 Length:419 Species:Homo sapiens


Alignment Length:572 Identity:112/572 - (19%)
Similarity:180/572 - (31%) Gaps:184/572 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PTAPHPFPSPNVWRQLLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCD 94
            |.:..|......|:.|||...:|:..:                    |.||.|..:..|   |..
Human     3 PLSAPPCTQHITWKGLLLTASLLNFWN--------------------PPTTAQVTIEAQ---PPK 44

  Fly    95 ISPQERDDAVYMV----------LWFREGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSST 149
            :|  |..|.:.:|          :|:: |....:|::.......||. :...|...|....:|: 
Human    45 VS--EGKDVLLLVHNLPQNLTGYIWYK-GQIRDLYHYVTSYIVDGQI-IKYGPAYSGRETVYSN- 104

  Fly   150 THPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNL--KINLTVIVPPDRPVIYGQNRHEKAGNVESF 212
               |.|.|.|:..||.|.|...:..|...|..:  :...|:.:...:|.|...|.:.:...    
Human   105 ---ASLLIQNVTQEDTGSYTLHIIKRGDGTGGVTGRFTFTLYLETPKPSISSSNFNPREAT---- 162

  Fly   213 SEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVAS 277
               ..::|:|:..  .|..:..|:::..::..:...:        ||..|        |.:.:..
Human   163 ---EAVILTCDPE--TPDASYLWWMNGQSLPMTHSLQ--------LSETN--------RTLYLFG 206

  Fly   278 NTNLTPPNNRVVILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKL 342
            .||.|            ..|....|...   |||.|:..|........|...||           
Human   207 VTNYT------------AGPYECEIRNP---VSASRSDPVTLNLLPKLPKPYIT----------- 245

  Fly   343 TKNFNEPDNQSLSILTFTPGREDDGKYLTCRAENQFIDGSAIEDKWRLIVHYQPTTTLKIGSSLN 407
            ..|.|..:|:.:|..|..|           ::||                               
Human   246 INNLNPRENKDVSTFTCEP-----------KSEN------------------------------- 268

  Fly   408 PDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTCL 472
                                  |...|:.||:.|..:......:.::.|:|.||:|...|.|.|.
Human   269 ----------------------YTYIWWLNGQSLPVSPRVKRRIENRILILPSVTRNETGPYQCE 311

  Fly   473 AVNSEGKGPSNPVTLRIRYAPICATDHEELLGALKHETLPLKCEVDSSPPADSFQWTFNS----S 533
            ..:..|...|:||||.:.|.|.....:.........:.|.|.|..||:||| .:.||.|.    |
Human   312 IRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYHSGQNLYLSCFADSNPPA-QYSWTINGKFQLS 375

  Fly   534 GEQTELP--ARLHSSETGMSRLNYTPSTDLDYGTISCWAKNS-IGTQKSPCV 582
            |::..:|  ...||                  |..:|..:|| .|.:.|..|
Human   376 GQKLSIPQITTKHS------------------GLYACSVRNSATGKESSKSV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 27/120 (23%)
Ig 210..281 CDD:472250 9/70 (13%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 12/74 (16%)
Ig strand C 329..333 CDD:409353 2/3 (67%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 0/4 (0%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 13/67 (19%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 20/88 (23%)
Ig strand B 511..515 CDD:409353 2/3 (67%)
Ig strand C 525..529 CDD:409353 0/3 (0%)
Ig strand E 551..555 CDD:409353 0/3 (0%)
Ig strand F 566..570 CDD:409353 1/3 (33%)
fn3 593..675 CDD:394996
PSG7NP_002774.2 Ig strand E 105..109 CDD:409430 2/3 (67%)
Ig strand F 119..124 CDD:409430 1/4 (25%)
Cell attachment site. /evidence=ECO:0000255 127..129 1/1 (100%)
IgI_hCEACAM_2_4_6_like 148..236 CDD:409402 21/127 (17%)
Ig strand A 148..152 CDD:409402 1/3 (33%)
Ig strand A' 155..160 CDD:409402 1/4 (25%)
Ig strand B 165..171 CDD:409402 2/5 (40%)
Ig strand C 178..183 CDD:409402 1/4 (25%)
Ig strand C' 185..188 CDD:409402 0/2 (0%)
Ig strand D 192..196 CDD:409402 0/11 (0%)
Ig strand E 199..204 CDD:409402 2/12 (17%)
Ig strand F 214..222 CDD:409402 2/7 (29%)
Ig strand G 226..235 CDD:409402 2/8 (25%)
Ig 241..329 CDD:472250 29/162 (18%)
Ig strand B 258..262 CDD:409353 1/3 (33%)
Ig strand C 271..275 CDD:409353 1/3 (33%)
Ig strand E 293..297 CDD:409353 1/3 (33%)
Ig strand F 307..312 CDD:409353 2/4 (50%)
Ig strand G 322..325 CDD:409353 1/2 (50%)
IgC2_CEACAM5-like 338..413 CDD:409540 23/91 (25%)
Ig strand A 338..344 CDD:409540 0/5 (0%)
Ig strand B 349..356 CDD:409540 3/6 (50%)
Ig strand C 362..368 CDD:409540 2/6 (33%)
Ig strand C' 371..376 CDD:409540 0/4 (0%)
Ig strand E 379..385 CDD:409540 1/5 (20%)
Ig strand F 388..399 CDD:409540 4/28 (14%)
Ig strand G 402..413 CDD:409540 3/8 (38%)
IgV_CEACAM_D1 36..127 CDD:409430 22/101 (22%)
FR1 37..55 CDD:409430 5/22 (23%)
Ig strand A 37..39 CDD:409430 0/1 (0%)
Ig strand A' 44..46 CDD:409430 0/1 (0%)
Ig strand B 49..56 CDD:409430 1/6 (17%)
CDR1 56..63 CDD:409430 0/6 (0%)
FR2 64..69 CDD:409430 1/4 (25%)
Ig strand C 64..68 CDD:409430 0/3 (0%)
CDR2 70..91 CDD:409430 4/21 (19%)
Ig strand C' 78..83 CDD:409430 0/4 (0%)
Ig strand C' 88..91 CDD:409430 0/3 (0%)
FR3 98..124 CDD:409430 9/29 (31%)
Ig strand D 98..103 CDD:409430 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.