DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and PSG4

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_047295059.1 Gene:PSG4 / 5672 HGNCID:9521 Length:435 Species:Homo sapiens


Alignment Length:531 Identity:107/531 - (20%)
Similarity:176/531 - (33%) Gaps:183/531 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PLTTVQGVLGRQAMLPCDISPQERDDAVYMV----------LWFREGDGEPIYNFDVRGRQFGQA 131
            |.||.|..:..|   |..:|  |..|.:.:|          :|:: |....:|::.......|| 
Human    46 PPTTAQVTIEAQ---PPKVS--EGKDVLLLVHNLPQNLAGYIWYK-GQMTYLYHYITSYVVDGQ- 103

  Fly   132 RLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNL--KINLTVIVPPDR 194
            |:...|...|....:|:    |.|.|.|:..||.|.|...:..|...|..:  ....|:.:...:
Human   104 RIIYGPAYSGRERVYSN----ASLLIQNVTQEDAGSYTLHIIKRRDGTGGVTGHFTFTLHLETPK 164

  Fly   195 PVIYGQNRHEKAGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLS 259
            |.|...|.:.:.. :|:      ::|:|:.:  .|..:..|::                  |..|
Human   165 PSISSSNLNPREA-MEA------VILTCDPA--TPAASYQWWM------------------NGQS 202

  Fly   260 YPNVGRQHLNSRLMCVASNTNLTPPNNRVVILDVNLKPIAVHILTKDRFVSADRTYDVECK---- 320
            .|...|..|        |.||.|                 :.|....::::.  .|:.|.:    
Human   203 LPMTHRLQL--------SKTNRT-----------------LFIFGVTKYIAG--PYECEIRNPVS 240

  Fly   321 SSGSKPPALITWWKGSKQLKKLTK------NFNEPDNQSLSILTFTPGREDDGKYLTCRAENQFI 379
            :|.|.|..|       ..|.||:|      |.|..:|:  .:|||           ||..::   
Human   241 ASRSDPVTL-------NLLPKLSKPYITINNLNPRENK--DVLTF-----------TCEPKS--- 282

  Fly   380 DGSAIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHN 444
                                                            |.|...|:.||:.|..:
Human   283 ------------------------------------------------KNYTYIWWLNGQSLPVS 299

  Fly   445 ISAGVILSDQSLVLQSVSRASAGDYTCLAVNSEGKGPSNPVTLRIRYAPICATDHEELLGALKHE 509
            ......:.::.|:|.:|:|...|.|.|...:..|...|:||||.:.|.|...:.:.........|
Human   300 PRVKRPIENRILILPNVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPSIYPSFTYYRSGE 364

  Fly   510 TLPLKCEVDSSPPADSFQWTFNS----SGEQTELP--ARLHSSETGMSRLNYTPSTDLDYGTISC 568
            .|.|.|..:|:|.| .:.||.|.    ||::..:|  ...||                  |..:|
Human   365 NLYLSCFAESNPRA-QYSWTINGKFQLSGQKLSIPQITTKHS------------------GLYAC 410

  Fly   569 WAKNSIGTQKS 579
            ..:||...::|
Human   411 SVRNSATGKES 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 28/120 (23%)
Ig 210..281 CDD:472250 12/70 (17%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 17/84 (20%)
Ig strand C 329..333 CDD:409353 1/3 (33%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 13/67 (19%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 19/87 (22%)
Ig strand B 511..515 CDD:409353 2/3 (67%)
Ig strand C 525..529 CDD:409353 0/3 (0%)
Ig strand E 551..555 CDD:409353 0/3 (0%)
Ig strand F 566..570 CDD:409353 1/3 (33%)
fn3 593..675 CDD:394996
PSG4XP_047295059.1 IgV_CEACAM_D1 52..154 CDD:409430 25/112 (22%)
FR1 53..71 CDD:409430 5/22 (23%)
Ig strand A 53..55 CDD:409430 0/1 (0%)
Ig strand A' 60..62 CDD:409430 0/1 (0%)
Ig strand B 65..72 CDD:409430 1/6 (17%)
CDR1 72..79 CDD:409430 0/6 (0%)
FR2 80..85 CDD:409430 1/4 (25%)
Ig strand C 80..84 CDD:409430 0/3 (0%)
CDR2 86..107 CDD:409430 5/21 (24%)
Ig strand C' 94..99 CDD:409430 0/4 (0%)
Ig strand C' 104..107 CDD:409430 1/2 (50%)
FR3 114..140 CDD:409430 9/29 (31%)
Ig strand D 114..119 CDD:409430 0/4 (0%)
Ig strand E 121..125 CDD:409430 2/3 (67%)
Ig strand F 135..140 CDD:409430 1/4 (25%)
CDR3 141..148 CDD:409430 1/6 (17%)
Ig strand G 149..154 CDD:409430 0/4 (0%)
IgI_hCEACAM_2_4_6_like 164..252 CDD:409402 24/148 (16%)
Ig strand A 164..168 CDD:409402 1/3 (33%)
Ig strand A' 171..176 CDD:409402 1/4 (25%)
Ig strand B 181..187 CDD:409402 2/5 (40%)
Ig strand C 194..199 CDD:409402 1/22 (5%)
Ig strand C' 201..204 CDD:409402 1/2 (50%)
Ig strand D 208..212 CDD:409402 2/11 (18%)
Ig strand E 215..220 CDD:409402 2/21 (10%)
Ig strand F 230..238 CDD:409402 2/7 (29%)
Ig strand G 242..251 CDD:409402 4/15 (27%)
IgI_hCEACAM_2_4_6_like 257..345 CDD:409402 28/151 (19%)
Ig strand A 257..261 CDD:409402 1/3 (33%)
Ig strand A' 264..269 CDD:409402 2/4 (50%)
Ig strand B 274..280 CDD:409402 5/16 (31%)
Ig strand C 287..292 CDD:409402 1/4 (25%)
Ig strand C' 294..297 CDD:409402 0/2 (0%)
Ig strand D 301..305 CDD:409402 0/3 (0%)
Ig strand E 308..313 CDD:409402 1/4 (25%)
Ig strand F 323..331 CDD:409402 2/7 (29%)
Ig strand G 335..344 CDD:409402 5/8 (63%)
IgC2_CEACAM5-like 354..429 CDD:409540 20/87 (23%)
Ig strand A 354..360 CDD:409540 0/5 (0%)
Ig strand B 365..372 CDD:409540 3/6 (50%)
Ig strand C 378..384 CDD:409540 2/6 (33%)
Ig strand C' 387..392 CDD:409540 0/4 (0%)
Ig strand E 395..401 CDD:409540 1/5 (20%)
Ig strand F 404..415 CDD:409540 4/28 (14%)
Ig strand G 418..429 CDD:409540 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.