DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and PSG3

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_066296.2 Gene:PSG3 / 5671 HGNCID:9520 Length:428 Species:Homo sapiens


Alignment Length:568 Identity:121/568 - (21%)
Similarity:185/568 - (32%) Gaps:183/568 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PTAPHPFPSPNVWRQLLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVL--------- 85
            |.:..|......|:.|||..|:|:               ..||.     ||.|..:         
Human     3 PLSAPPCTQRITWKGLLLTALLLN---------------FWNLP-----TTAQVTIEAEPTKVSK 47

  Fly    86 GRQAMLPCDISPQERDDAVYMVLWFREGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSSTT 150
            |:..:|.....||..  |.|  :|:: |..:.:|::.......||..:: .|...|....:|:  
Human    48 GKDVLLLVHNLPQNL--AGY--IWYK-GQMKDLYHYITSYVVDGQIIIY-GPAYSGRETVYSN-- 104

  Fly   151 HPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSEG 215
              |.|.|.|:..||.|.|...:..|...||                  |:..|        |:  
Human   105 --ASLLIQNVTREDAGSYTLHIVKRGDGTR------------------GETGH--------FT-- 139

  Fly   216 NDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVASNTN 280
              ..|..|.    |:|::                                           |::|
Human   140 --FTLYLET----PKPSI-------------------------------------------SSSN 155

  Fly   281 LTPPNNRVVILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLK----- 340
            |.|                     ::...:...|.|.|      .|.|...||...:.|.     
Human   156 LYP---------------------REDMEAVSLTCDPE------TPDASYLWWMNGQSLPMTHSL 193

  Fly   341 KLTKNFNEPDNQSLSILTFTPGREDDGKYLTCRAENQFIDGSAIEDKWRLIVHYQPTTTLKIGSS 405
            :|:||       ..::..|...:...|.| .|...|. :..|..:.....::...|...:.| ::
Human   194 QLSKN-------KRTLFLFGVTKYTAGPY-ECEIRNP-VSASRSDPVTLNLLPKLPKPYITI-NN 248

  Fly   406 LNPDDIKEGDDAYFECIVLANPKP--YKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASAGD 468
            |||.:.|  |...|.|    .||.  |...|:.||:.|..:......:.::.|:|.||:|...|.
Human   249 LNPRENK--DVLAFTC----EPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGP 307

  Fly   469 YTCLAVNSEGKGPSNPVTLRIRYAPICATDHEELLGALKHETLPLKCEVDSSPPADSFQWTFNS- 532
            |.|...:..|...|.||||.:.|.|.....:.........|.|.|.|..||:|||: :.||.|. 
Human   308 YQCEIQDRYGGIRSYPVTLNVLYGPDLPRIYPSFTYYHSGENLYLSCFADSNPPAE-YSWTINGK 371

  Fly   533 ---SGEQTELP-----------ARLHSSETGM-SRLNYTPSTDLDYGT 565
               ||::..:|           ..:.:|.||| |..:.|.......||
Human   372 FQLSGQKLFIPQITTKHSGLYACSVRNSATGMESSKSMTVKVSAPSGT 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 28/117 (24%)
Ig 210..281 CDD:472250 6/70 (9%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 15/79 (19%)
Ig strand C 329..333 CDD:409353 0/3 (0%)
Ig strand E 355..359 CDD:409353 0/3 (0%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 19/69 (28%)
Ig strand B 417..421 CDD:409353 1/3 (33%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 23/88 (26%)
Ig strand B 511..515 CDD:409353 2/3 (67%)
Ig strand C 525..529 CDD:409353 0/3 (0%)
Ig strand E 551..555 CDD:409353 1/3 (33%)
Ig strand F 566..570 CDD:409353 121/568 (21%)
fn3 593..675 CDD:394996
PSG3NP_066296.2 IgV_CEACAM_D1 36..138 CDD:409430 27/137 (20%)
FR1 37..55 CDD:409430 2/17 (12%)
Ig strand A 37..39 CDD:409430 0/1 (0%)
Ig strand A' 44..46 CDD:409430 0/1 (0%)
Ig strand B 49..56 CDD:409430 1/6 (17%)
CDR1 56..63 CDD:409430 2/8 (25%)
FR2 64..69 CDD:409430 2/6 (33%)
Ig strand C 64..68 CDD:409430 1/5 (20%)
CDR2 70..91 CDD:409430 4/20 (20%)
Ig strand C' 78..83 CDD:409430 0/4 (0%)
Ig strand C' 88..91 CDD:409430 0/2 (0%)
FR3 98..124 CDD:409430 9/29 (31%)
Ig strand D 98..103 CDD:409430 0/4 (0%)
Ig strand E 105..109 CDD:409430 2/3 (67%)
Ig strand F 119..124 CDD:409430 1/4 (25%)
CDR3 125..132 CDD:409430 1/6 (17%)
Cell attachment site. /evidence=ECO:0000255 127..129 1/1 (100%)
Ig strand G 133..138 CDD:409430 2/12 (17%)
IgI_hCEACAM_2_4_6_like 148..236 CDD:409402 22/166 (13%)
Ig strand A 148..152 CDD:409402 1/46 (2%)
Ig strand A' 155..160 CDD:409402 3/25 (12%)
Ig strand B 165..171 CDD:409402 1/5 (20%)
Ig strand C 178..183 CDD:409402 2/4 (50%)
Ig strand C' 185..188 CDD:409402 0/2 (0%)
Ig strand D 192..196 CDD:409402 0/3 (0%)
Ig strand E 199..204 CDD:409402 0/4 (0%)
Ig strand F 214..222 CDD:409402 2/8 (25%)
Ig strand G 226..235 CDD:409402 1/8 (13%)
Ig 241..329 CDD:472250 29/94 (31%)
Ig strand B 258..262 CDD:409402 1/3 (33%)
Ig strand C 271..275 CDD:409402 1/3 (33%)
Ig strand E 293..297 CDD:409402 1/3 (33%)
Ig strand F 307..312 CDD:409402 2/4 (50%)
Ig strand G 322..325 CDD:409402 1/2 (50%)
IgC2_CEACAM5-like 338..413 CDD:409540 21/75 (28%)
Ig strand A 338..344 CDD:409540 0/5 (0%)
Ig strand B 349..356 CDD:409540 3/6 (50%)
Ig strand C 362..368 CDD:409540 2/6 (33%)
Ig strand C' 371..376 CDD:409540 0/4 (0%)
Ig strand E 379..385 CDD:409540 1/5 (20%)
Ig strand F 388..399 CDD:409540 0/10 (0%)
Ig strand G 402..413 CDD:409540 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.