DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and PSG2

DIOPT Version :9

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_112536.2 Gene:PSG2 / 5670 HGNCID:9519 Length:335 Species:Homo sapiens


Alignment Length:242 Identity:67/242 - (27%)
Similarity:99/242 - (40%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 NQSLSILTFTPGREDDGKY---LTCRAENQFIDGSAIEDKWRLIVHYQPTTTLKIGSS-LNPDDI 411
            |.||.|...|  |||.|.|   :..|.     ||:.....:.....|..|....|.|| |||.:.
Human   104 NASLLIQNVT--REDAGSYTLHIIKRG-----DGTRGVTGYFTFTLYLETPKPSISSSNLNPREA 161

  Fly   412 KEGDDAYFECIVLANPKPYKMS--WFHNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTCLAV 474
            .|      ..|:..:|:....|  |:.||:.|.......:..::::|.|..|::.:||.|.|...
Human   162 ME------TVILTCDPETPDTSYQWWMNGQSLPMTHRFQLSETNRTLFLFGVTKYTAGPYECEIR 220

  Fly   475 NSEGKGPSNPVTLRIRYAPICATDHEELLGALKHETLPLKCEVDSSPPADSFQWT----FNSSGE 535
            ||.....|:||||.:.:.|.....|.........:.|.|.|..:|:||| .:.||    |..||:
Human   221 NSGSASRSDPVTLNLLHGPDLPRIHPSYTNYRSGDNLYLSCFANSNPPA-QYSWTINGKFQQSGQ 284

  Fly   536 QTELPARLHSSETGM-------SRLNYTPSTDLDYGTISCWAKNSIG 575
            ...:| ::.:..:|:       |......||.|   |:...|...||
Human   285 NLFIP-QITTKHSGLYVCSVRNSATGEESSTSL---TVKVSASTRIG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:284989
IG_like 80..188 CDD:214653
Ig 210..281 CDD:299845
Ig 319..392 CDD:299845 13/43 (30%)
IG_like 319..383 CDD:214653 13/34 (38%)
IG_like 412..489 CDD:214653 22/78 (28%)
IGc2 413..478 CDD:197706 17/66 (26%)
Ig_3 509..572 CDD:290638 20/73 (27%)
fn3 593..675 CDD:278470
PSG2NP_112536.2 Ig_CEACAM_D1 36..138 CDD:143251 13/40 (33%)
IG_like 45..>121 CDD:214653 9/18 (50%)
Ig 148..236 CDD:299845 28/93 (30%)
Ig_2 242..320 CDD:290606 20/82 (24%)
IG_like 246..318 CDD:214653 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.