DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and PSG1

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001284702.1 Gene:PSG1 / 5669 HGNCID:9514 Length:428 Species:Homo sapiens


Alignment Length:564 Identity:114/564 - (20%)
Similarity:180/564 - (31%) Gaps:204/564 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WRQLLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDAVYM 106
            |:.|||...:|:               ..||.     ||.|..:..:   |..:|  |..|.:.:
Human    15 WKGLLLTASLLN---------------FWNLP-----TTAQVTIEAE---PTKVS--EGKDVLLL 54

  Fly   107 V----------LWFREGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIR 161
            |          :|:: |....:|::.......|:..:: .|...|....:|:    |.|.|.|:.
Human    55 VHNLPQNLTGYIWYK-GQMRDLYHYITSYVVDGEIIIY-GPAYSGRETAYSN----ASLLIQNVT 113

  Fly   162 IEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLSCEVSG 226
            .||.|.|...:...:..||.:....|                              ..|..|.  
Human   114 REDAGSYTLHIIKGDDGTRGVTGRFT------------------------------FTLHLET-- 146

  Fly   227 GRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVASNTNLTPPNNRVVIL 291
              |:|::                                           |::||.|        
Human   147 --PKPSI-------------------------------------------SSSNLNP-------- 158

  Fly   292 DVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLK-----KLTKNFNEPDN 351
                         ::...:...|.|.|      .|.|...||...:.|.     ||::.     |
Human   159 -------------RETMEAVSLTCDPE------TPDASYLWWMNGQSLPMTHSLKLSET-----N 199

  Fly   352 QSLSILTFTPGREDDGKYLTCRAENQFIDGSAIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDD 416
            ::|.:|..|  :...|.| .|...|. :..|..:.....::...|...:.| ::|||.:.|  |.
Human   200 RTLFLLGVT--KYTAGPY-ECEIRNP-VSASRSDPVTLNLLPKLPKPYITI-NNLNPRENK--DV 257

  Fly   417 AYFECIVLANPKP--YKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTCLAVNSEGK 479
            ..|.|    .||.  |...|:.||:.|..:......:.::.|:|.||:|...|.|.|...:..|.
Human   258 LNFTC----EPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGG 318

  Fly   480 GPSNPVTLRIRYAPICATDHEELLGALKHETLPLKCEVDSSPPADSFQWTFNSSGEQTELPAR-- 542
            ..|:||||.:.|.|.....:.........|.|.|.|..||:||| .:.||.|   |:.:||.:  
Human   319 IRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPA-QYSWTIN---EKFQLPGQKL 379

  Fly   543 ----------------LHSSETG--------------MSRLNYT 556
                            :.:|.||              .|.:|||
Human   380 FIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSAYSSSINYT 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 25/118 (21%)
Ig 210..281 CDD:472250 5/70 (7%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 17/79 (22%)
Ig strand C 329..333 CDD:409353 0/3 (0%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 19/69 (28%)
Ig strand B 417..421 CDD:409353 1/3 (33%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 22/95 (23%)
Ig strand B 511..515 CDD:409353 2/3 (67%)
Ig strand C 525..529 CDD:409353 0/3 (0%)
Ig strand E 551..555 CDD:409353 1/3 (33%)
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
PSG1NP_001284702.1 IgV_CEACAM_D1 36..138 CDD:409430 22/112 (20%)
FR1 37..55 CDD:409430 4/22 (18%)
Ig strand A 37..39 CDD:409430 0/1 (0%)
Ig strand A' 44..46 CDD:409430 0/1 (0%)
Ig strand B 49..56 CDD:409430 1/6 (17%)
CDR1 56..63 CDD:409430 0/6 (0%)
FR2 64..69 CDD:409430 1/4 (25%)
Ig strand C 64..68 CDD:409430 0/3 (0%)
CDR2 70..91 CDD:409430 3/20 (15%)
Ig strand C' 78..83 CDD:409430 0/4 (0%)
Ig strand C' 88..91 CDD:409430 0/2 (0%)
FR3 98..124 CDD:409430 9/29 (31%)
Ig strand D 98..103 CDD:409430 0/4 (0%)
Ig strand E 105..109 CDD:409430 2/3 (67%)
Ig strand F 119..124 CDD:409430 1/4 (25%)
CDR3 125..132 CDD:409430 0/6 (0%)
Ig strand G 133..138 CDD:409430 0/4 (0%)
IgI_hCEACAM_2_4_6_like 148..236 CDD:409402 24/166 (14%)
Ig strand A 148..152 CDD:409402 1/46 (2%)
Ig strand A' 155..160 CDD:409402 3/25 (12%)
Ig strand B 165..171 CDD:409402 1/5 (20%)
Ig strand C 178..183 CDD:409402 2/4 (50%)
Ig strand C' 185..188 CDD:409402 0/2 (0%)
Ig strand D 192..196 CDD:409402 1/3 (33%)
Ig strand E 199..204 CDD:409402 2/4 (50%)
Ig strand F 214..222 CDD:409402 2/8 (25%)
Ig strand G 226..235 CDD:409402 1/8 (13%)
Ig 241..329 CDD:472250 29/94 (31%)
Ig strand B 258..262 CDD:409402 1/3 (33%)
Ig strand C 271..275 CDD:409402 1/3 (33%)
Ig strand E 293..297 CDD:409402 1/3 (33%)
Ig strand F 307..312 CDD:409402 2/4 (50%)
Ig strand G 322..325 CDD:409402 1/2 (50%)
IgC2_CEACAM5-like 338..413 CDD:409540 18/78 (23%)
Ig strand A 338..344 CDD:409540 0/5 (0%)
Ig strand B 349..356 CDD:409540 3/6 (50%)
Ig strand C 362..368 CDD:409540 2/6 (33%)
Ig strand C' 371..376 CDD:409540 1/4 (25%)
Ig strand E 379..385 CDD:409540 0/5 (0%)
Ig strand F 388..399 CDD:409540 0/10 (0%)
Ig strand G 402..413 CDD:409540 1/10 (10%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.