DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and si:ch211-214p13.3

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_693160.2 Gene:si:ch211-214p13.3 / 564737 ZFINID:ZDB-GENE-060503-779 Length:225 Species:Danio rerio


Alignment Length:176 Identity:44/176 - (25%)
Similarity:64/176 - (36%) Gaps:33/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 CKSSGSKPPALITWWKG--SKQLKKLTKNFNEPDN--QSLSILTFTPGREDDGKYLTC------- 372
            |.....|..|.::|..|  |..||..:.|....|.  ...|.|...|..:.:.:.:.|       
Zfish    50 CTVISEKTAARVSWRLGSLSDSLKPSSNNVQHLDGIFTVSSSLIAVPTVQMNQQLVQCVITHDTR 114

  Fly   373 RAENQFIDGSAIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDDAY---FECIVLANPKPYKMSW 434
            :||        ||...|:.|||.|...     ::.|.:    |.:|   |:|...|||.....:|
Zfish   115 KAE--------IEIDHRIKVHYPPQLV-----TVTPFN----DPSYAEVFQCEADANPPATDFTW 162

  Fly   435 FHNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTCLAVNSEGKG 480
             |:.|.:.....| :.:....|....:|....|.|.|.|.|..|.|
Zfish   163 -HSSKHVTIPNDA-IEIKGNKLYFLKLSSDLNGVYFCNASNMYGAG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230
Ig 210..281 CDD:472250
Ig strand B 218..222 CDD:409353
Ig strand C 232..236 CDD:409353
Ig <317..392 CDD:472250 19/83 (23%)
Ig strand C 329..333 CDD:409353 0/3 (0%)
Ig strand E 355..359 CDD:409353 2/3 (67%)
Ig strand F 369..374 CDD:409353 1/11 (9%)
Ig strand G 385..388 CDD:409353 1/2 (50%)
Ig 411..479 CDD:472250 18/70 (26%)
Ig strand B 417..421 CDD:409353 2/6 (33%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
si:ch211-214p13.3XP_693160.2 Ig 39..113 CDD:472250 14/62 (23%)
Ig strand B 46..50 CDD:409353 44/176 (25%)
Ig strand C 60..64 CDD:409353 0/3 (0%)
Ig strand E 90..94 CDD:409353 2/3 (67%)
Ig strand F 104..109 CDD:409353 1/4 (25%)
Ig 129..204 CDD:472250 20/85 (24%)
Ig strand B 141..149 CDD:409353 2/7 (29%)
Ig strand C 158..163 CDD:409353 1/5 (20%)
Ig strand E 180..184 CDD:409353 1/3 (33%)
Ig strand F 194..199 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.