DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and nectin1b

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_073785262.1 Gene:nectin1b / 557665 ZFINID:ZDB-GENE-090224-2 Length:594 Species:Danio rerio


Alignment Length:373 Identity:91/373 - (24%)
Similarity:137/373 - (36%) Gaps:111/373 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 RNLKINLTVIVPPDRP--VIYGQN----RHEKAGNVESFSE--------GNDIVLSCEVSGGRPR 230
            |..:::....||...|  :::..|    :..:|||.:|...        |:.:.|.|....|:|.
Zfish    28 RTSRLSECYTVPLQWPHGIVWHNNNSLLKGLEAGNGQSVQTDPSKSGFVGDTVELKCLFINGKPP 92

  Fly   231 ---PNVTWY-----------LDNTAIDES----FEQRPDGKTINHLSYPNVGRQHLNSRL---MC 274
               ..|||.           :.|.|:..|    |:.|...|      :|.| ||...|.|   ..
Zfish    93 VKISQVTWQKLINGTKQNVAIANPALGVSVLTPFKDRVSFK------HPAV-RQRTPSSLEDTTI 150

  Fly   275 VASNTNLT------------PPNNR--VVILDVNLKPIAVHILTKDRFVSADRTYD-----VECK 320
            |.|:..|:            |..||  :|.|.|..:|:....||....|:  ||..     ..|.
Zfish   151 VFSSLRLSDEAAYICEYTTFPAGNRENMVNLTVFARPVTKMTLTSPTIVA--RTPKRKMPVATCM 213

  Fly   321 SSGSKPPALITW---WKGSKQLKKLTKNFNEPDNQSLSILT---FTPGREDDGKYLTC----RAE 375
            |:..|||::|.|   .||....:: |:|    .|.::::.:   ..|.||...:.|||    |:|
Zfish   214 SANGKPPSVIKWDTTLKGEATFQE-TRN----PNGTVTVRSNYIVLPSRETHRQKLTCIVTYRSE 273

  Fly   376 NQFIDGSAIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDD---------AYFECIVLANPKPYK 431
             :|.| |.|     |.|.|:|...:            ||.|         ....|...|||....
Zfish   274 -RFTD-SVI-----LNVQYEPEVKI------------EGFDGNWYLNRPNVQLTCNADANPPVTV 319

  Fly   432 MSWFHNGKELQHNISAGVILSDQSLVLQS-VSRASAGDYTCLAVNSEG 478
            ..|    |.|..::...:.:.:.:|..:. |:....|.|.|.|.||.|
Zfish   320 YQW----KLLNGSLPNNIEIKNNTLFFKGPVTYELGGTYVCEATNSIG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 1/7 (14%)
Ig 210..281 CDD:472250 23/99 (23%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 2/3 (67%)
Ig <317..392 CDD:472250 25/84 (30%)
Ig strand C 329..333 CDD:409353 2/6 (33%)
Ig strand E 355..359 CDD:409353 0/6 (0%)
Ig strand F 369..374 CDD:409353 3/8 (38%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 19/78 (24%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
nectin1bXP_073785262.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.