DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and F11R

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens


Alignment Length:253 Identity:55/253 - (21%)
Similarity:89/253 - (35%) Gaps:79/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PAQLKIDNIRIEDEGVYRCRVDFRNSPT-RNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSE- 214
            |..:...::..||.|.|.|.|......: ..:|:.|.|:|||.:|.:          |:.|.:. 
Human    91 PTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTV----------NIPSSATI 145

  Fly   215 GNDIVLSCEVSGGRPRPNVTWYLDNTAI-----------DESFEQRP-DGKTI-NHLSYPNVGRQ 266
            ||..||:|....|.|....||:.|...:           :.|:...| .|:.: :.||..:.|  
Human   146 GNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTG-- 208

  Fly   267 HLNSRLMCVASNTNLTPPNNRVVILDV---NLKPIAVHILTK--------------------DR- 307
                ...|.|.|...||..:..|.::.   |:..|...:|..                    |: 
Human   209 ----EYSCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDKL 269

  Fly   308 ------------FVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPDNQS 353
                        |..|| |:|.....||:|        ||:...|.:   :::|..:|
Human   270 GACPSIFPSHAVFCPAD-THDPISSLSGTK--------KGTSSKKVI---YSQPSARS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 9/36 (25%)
Ig 210..281 CDD:472250 20/84 (24%)
Ig strand B 218..222 CDD:409353 2/3 (67%)
Ig strand C 232..236 CDD:409353 1/3 (33%)
Ig <317..392 CDD:472250 8/37 (22%)
Ig strand C 329..333 CDD:409353 0/3 (0%)
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 9/37 (24%)
FR1 30..52 CDD:409538
Ig strand A 30..33 CDD:409538
Ig strand A' 37..41 CDD:409538
Ig strand B 44..53 CDD:409538
CDR1 53..58 CDD:409538
Ig strand C 58..66 CDD:409538
FR2 59..66 CDD:409538
CDR2 69..83 CDD:409538
Ig strand C' 69..74 CDD:409538
Ig strand C' 77..79 CDD:409538
FR3 84..112 CDD:409538 6/20 (30%)
Ig strand D 86..90 CDD:409538
Ig strand E 92..96 CDD:409538 0/3 (0%)
Ig strand F 105..113 CDD:409538 4/7 (57%)
CDR3 113..119 CDD:409538 0/5 (0%)
Ig strand G 119..128 CDD:409538 2/8 (25%)
FR4 120..129 CDD:409538 2/8 (25%)
IgI_2_JAM1 135..231 CDD:409542 25/111 (23%)
Ig strand A 135..139 CDD:409542 1/13 (8%)
Ig strand A' 141..144 CDD:409542 1/2 (50%)
Ig strand B 147..155 CDD:409542 4/7 (57%)
Ig strand C 163..168 CDD:409542 2/4 (50%)
Ig strand C' 170..172 CDD:409542 0/1 (0%)
Ig strand D 187..191 CDD:409542 1/3 (33%)
Ig strand E 195..199 CDD:409542 1/3 (33%)
Ig strand F 208..214 CDD:409542 2/11 (18%)
Ig strand G 221..231 CDD:409542 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.