DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and CEACAM6

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_002474.4 Gene:CEACAM6 / 4680 HGNCID:1818 Length:344 Species:Homo sapiens


Alignment Length:349 Identity:79/349 - (22%)
Similarity:121/349 - (34%) Gaps:125/349 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 PIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPDNQSLSILTFTP 361
            |..:|:..|:..::|                :|:|:|             |.|....|:|.: ||
Human     8 PCRLHVPWKEVLLTA----------------SLLTFW-------------NPPTTAKLTIES-TP 42

  Fly   362 GREDDGKYLTCRAEN-------------QFIDGSAIEDKWRLIVHY----QPTT---------TL 400
            ....:||.:...|.|             :.:||::      |||.|    |..|         |:
Human    43 FNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNS------LIVGYVIGTQQATPGPAYSGRETI 101

  Fly   401 KIGSSLNPDDIKEGDDAYFECIVLAN-----------------PKPYKMS--------------- 433
            ...:||...::.:.|..::...|:.:                 |||...|               
Human   102 YPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFT 166

  Fly   434 -----------WFHNGKELQHNISAGVILS--DQSLVLQSVSRASAGDYTCLAVNSEGKGPSNPV 485
                       |:.||:.|.  :|..:.||  :.:|.|.||.|..||.|.|...|......|:||
Human   167 CEPEVQNTTYLWWVNGQSLP--VSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPV 229

  Fly   486 TLRIRYAPICATDHEELLGALKHETLPLKCEVDSSPPADSFQW----TFNSSGEQTELP------ 540
            ||.:.|.|...|...........|.|.|.|...|:||| .:.|    ||..|.::..:|      
Human   230 TLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPA-QYSWFINGTFQQSTQELFIPNITVNN 293

  Fly   541 -----ARLHSSETGMSRLNYTPST 559
                 .:.|:|.||::|...|..|
Human   294 SGSYMCQAHNSATGLNRTTVTMIT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230
Ig 210..281 CDD:472250
Ig strand B 218..222 CDD:409353
Ig strand C 232..236 CDD:409353
Ig <317..392 CDD:472250 16/87 (18%)
Ig strand C 329..333 CDD:409353 2/3 (67%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 0/4 (0%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 23/112 (21%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 1/29 (3%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 21/81 (26%)
Ig strand B 511..515 CDD:409353 2/3 (67%)
Ig strand C 525..529 CDD:409353 1/7 (14%)
Ig strand E 551..555 CDD:409353 1/3 (33%)
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
CEACAM6NP_002474.4 IgV_CEACAM_D1 36..140 CDD:409430 21/110 (19%)
FR1 37..55 CDD:409430 5/18 (28%)
Ig strand A 37..39 CDD:409430 0/1 (0%)
Ig strand A' 44..46 CDD:409430 0/1 (0%)
Ig strand B 49..56 CDD:409430 1/6 (17%)
CDR1 56..63 CDD:409430 1/6 (17%)
FR2 64..69 CDD:409430 0/4 (0%)
Ig strand C 64..68 CDD:409430 0/3 (0%)
CDR2 70..91 CDD:409430 7/26 (27%)
Ig strand C' 78..83 CDD:409430 3/4 (75%)
Ig strand C' 88..91 CDD:409430 0/2 (0%)
FR3 98..124 CDD:409430 4/25 (16%)
Ig strand D 98..103 CDD:409430 1/4 (25%)
Ig strand E 105..109 CDD:409430 2/3 (67%)
Ig strand F 119..124 CDD:409430 0/4 (0%)
CDR3 125..132 CDD:409430 0/6 (0%)
FR4 133..140 CDD:409430 0/6 (0%)
Ig strand G 133..139 CDD:409430 0/5 (0%)
IgI_hCEACAM_2_4_6_like 146..234 CDD:409402 25/89 (28%)
Ig strand A 146..150 CDD:409402 2/3 (67%)
Ig strand A' 153..158 CDD:409402 0/4 (0%)
Ig strand B 163..169 CDD:409402 0/5 (0%)
Ig strand C 176..181 CDD:409402 1/4 (25%)
Ig strand C' 183..186 CDD:409402 0/2 (0%)
Ig strand D 190..194 CDD:409402 0/3 (0%)
Ig strand E 197..202 CDD:409402 1/4 (25%)
Ig strand F 212..220 CDD:409402 2/7 (29%)
Ig strand G 224..233 CDD:409402 5/8 (63%)
IgC2_CEACAM5-like 243..318 CDD:409540 20/76 (26%)
Ig strand A 243..249 CDD:409540 0/5 (0%)
Ig strand B 254..261 CDD:409540 3/6 (50%)
Ig strand C 267..273 CDD:409540 2/6 (33%)
Ig strand C' 276..281 CDD:409540 2/4 (50%)
Ig strand E 284..290 CDD:409540 1/5 (20%)
Ig strand F 293..304 CDD:409540 1/10 (10%)
Ig strand G 307..318 CDD:409540 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.