DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Btnl8

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_063135416.1 Gene:Btnl8 / 406160 RGDID:1303010 Length:595 Species:Rattus norvegicus


Alignment Length:165 Identity:37/165 - (22%)
Similarity:63/165 - (38%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PLTTVQGVLGRQAMLPCDISPQERDDAVYMVLWFREGDGEPIYNFDVRGRQFGQARL---WSSPT 138
            |...|....||:|:|||.:||....:.:..:.|||....:.::.:..:..|..:..:   |.: :
  Rat    36 PSDPVVAAPGREAILPCSVSPAMSVENMEELRWFRTRFSQAVFVYRDQEEQKEEQMIEYSWRT-S 99

  Fly   139 AFGTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRV---DFRNSPTRNLKINLTVIVPPDRPVIYGQ 200
            ....:.|...    |.::|.|::..|.|:|.|..   .|.......||:.....||.    :|.:
  Rat   100 LVKDKFHEGK----AAVRIQNVQESDSGIYVCHFKQGHFHEEAILELKVAAMGSVPE----VYIK 156

  Fly   201 NRHEKAGNVESFSEGNDIVLSCEVSGGRPRPNVTW 235
            .           .|...:.:.|..||..|.|.|.|
  Rat   157 G-----------PEDGGVCVVCMTSGWYPEPQVHW 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 25/114 (22%)
Ig 210..281 CDD:472250 8/26 (31%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 2/4 (50%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Btnl8XP_063135416.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.