DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and SIGLEC16

DIOPT Version :9

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001335293.2 Gene:SIGLEC16 / 400709 HGNCID:24851 Length:481 Species:Homo sapiens


Alignment Length:585 Identity:123/585 - (21%)
Similarity:194/585 - (33%) Gaps:197/585 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDIS-PQERDDAVYMVL 108
            ||||:|....:::..|..::       :.|.||:..     |...::.|::| |::..|      
Human     6 LLLPVLGAGSLNKDPSYSLQ-------VQRQVPVPE-----GLCVIVSCNLSYPRDGWD------ 52

  Fly   109 WFREGDGEPIYNFDVRGRQFGQARLWSSP--------------TAFGTRAHFSSTTHPAQ----L 155
                 :....|.:..:|        |:||              ....||..|..|..|.:    |
Human    53 -----ESTAAYGYWFKG--------WTSPKTGAPVATNNQSREVEMSTRDRFQLTGDPGKGSCSL 104

  Fly   156 KIDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVL 220
            .|.:.:.|||..|..||:      |..::                 ||....|:           
Human   105 VIRDAQREDEAWYFFRVE------RGSRV-----------------RHSFVNNL----------- 135

  Fly   221 SCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVASNTNLTPPN 285
                          ::|..||:    .|:||                       |.....|.|. 
Human   136 --------------FFLKVTAL----TQKPD-----------------------VYIPETLEPG- 158

  Fly   286 NRVVILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPD 350
                      :|:.|..:....|               .|.||....|.|:....:.|:    |.
Human   159 ----------QPVTVICVFNWAF---------------KKCPAPSFSWTGAALSPRRTR----PS 194

  Fly   351 NQSLSILTFTPGREDDGKYLTCRAENQFIDGSAIEDKWRLIVHYQPTTTLKIGS-SLNPD----D 410
            ....|:|:|||..:|....|||.     :|.|      |..|..|.|..|::.| .|..:    :
Human   195 TSHFSVLSFTPSPQDHDTDLTCH-----VDFS------RKGVSAQRTVRLRVASLELQGNVIYLE 248

  Fly   411 IKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTCLAVN 475
            :::|......|...:.| |..:||....:.|..:...|.  ....|.|:.|....:|.|||.|.|
Human   249 VQKGQFLRLLCAADSQP-PATLSWVLQDRVLSSSHPWGP--RTLGLELRGVRAGDSGRYTCRAEN 310

  Fly   476 SEGKGPS--------NPVTLRIRYAPICATDHEEL-----LGALKHETLPLKCEVDSSPPADSFQ 527
            ..|....        .|..||:..:....|..|.|     |..|:.::|.|.|...||||| ...
Human   311 RLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLRNGTSLRVLEGQSLRLVCVTHSSPPA-RLS 374

  Fly   528 WTFNSSGEQTELPARLHSSETGMSRLNYTPSTDLDY-GTISCWAKNSIGTQKSPCVFQIVAAGRP 591
            ||   ...||..|::  .|:.|:..|   |...::: |..:|.|::.:|:|:....|.:.....|
Human   375 WT---RWGQTVGPSQ--PSDPGVLEL---PRVQMEHEGEFTCHARHPLGSQRVSLSFSVHCKSGP 431

  Fly   592  591
            Human   432  431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:284989 24/127 (19%)
IG_like 80..188 CDD:214653 24/126 (19%)
Ig 210..281 CDD:299845 7/70 (10%)
Ig 319..392 CDD:299845 19/72 (26%)
IG_like 319..383 CDD:214653 17/63 (27%)
IG_like 412..489 CDD:214653 20/84 (24%)
IGc2 413..478 CDD:197706 17/64 (27%)
Ig_3 509..572 CDD:290638 20/63 (32%)
fn3 593..675 CDD:278470
SIGLEC16NP_001335293.2 Ig_Siglec_N 22..141 CDD:143189 31/197 (16%)
IG_like 247..323 CDD:214653 18/78 (23%)
IG_like 350..425 CDD:214653 25/83 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.