DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and side-VIII

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster


Alignment Length:220 Identity:43/220 - (19%)
Similarity:80/220 - (36%) Gaps:58/220 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AESICFITATID-----SLEDLV-------ACSSMNSVNNV---------HDMNTVSSSSSSSAP 103
            |::||.:.:|..     |.:|::       |.|..:.|||.         |.:|..:.:....| 
  Fly   228 ADAICCVLSTTSCFAPRSSDDVIELGKLCKAHSIPHVVNNAYGLQSSYYCHQLNQAARTGRVDA- 291

  Fly   104 LFVALYDFHGVGEEQLSLRKGDQVRILGYNKNNEWCEARLYSTRKNDASNQRRLGEIGWVPSNFI 168
             |:...|      :.|.:..|..: :.|.:.:.....||||..|   ||..:.|..:..:.|...
  Fly   292 -FIQSTD------KNLLVPVGGAI-VAGSSADTVDAVARLYPGR---ASGTQHLDVLMTLLSLGR 345

  Fly   169 APYNSLDKYTWYHGKISRSDSEAILGSGITGSFLVRESETSIGQYTISVRHDGRVFHYR--INVD 231
            ..|:.|.|        .|.::.|:|..|:.               .::..|:.|:...|  |::.
  Fly   346 NGYSDLLK--------ERKEAYAVLLEGLA---------------NLAKAHNERILPCRNPISIA 387

  Fly   232 NTEKMFITQEVKFRTLGELVHHHSV 256
            .:...|.|...:...:|.::....|
  Fly   388 MSLVTFETTTCRLEMIGSMLQKRGV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 25/117 (21%)
Ig 210..281 CDD:472250 8/49 (16%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
side-VIIINP_001097382.2 IG_like 60..166 CDD:214653
Ig strand B 69..72 CDD:409353
Ig strand C 85..89 CDD:409353
Ig strand E 131..135 CDD:409353
Ig strand F 145..150 CDD:409353
Ig 189..273 CDD:472250 11/44 (25%)
Ig strand B 197..201 CDD:409353
Ig strand C 211..215 CDD:409353
Ig strand E 237..241 CDD:409353 1/3 (33%)
Ig strand F 252..257 CDD:409353 0/4 (0%)
Ig strand G 267..270 CDD:409353 1/2 (50%)
Ig 290..373 CDD:472250 22/117 (19%)
Ig strand B 296..300 CDD:409353 1/9 (11%)
Ig strand C 310..314 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 2/12 (17%)
Ig strand G 366..369 CDD:409353 0/17 (0%)
Ig_3 377..456 CDD:464046 6/36 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.