DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Cadm2

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_038944379.1 Gene:Cadm2 / 360687 RGDID:1305678 Length:444 Species:Rattus norvegicus


Alignment Length:344 Identity:82/344 - (23%)
Similarity:136/344 - (39%) Gaps:69/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PLT-TVQGVLGRQAMLPCDISPQERDDAVYMVLWFREGDGEPIYNFDVRGRQFGQARLWSSPTAF 140
            ||| .|..|.|..|:|.|.:...:...    :.|..... :.:|..|.:..:..:..|       
  Rat    36 PLTQNVTVVEGGTAILTCRVDQNDNTS----LQWSNPAQ-QTLYFDDKKALRDNRIEL------- 88

  Fly   141 GTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEK 205
             .||.:    |...:.:.::.:.|||.|.|  .....|.:..|..|||:..|::|.|.|      
  Rat    89 -VRASW----HELSISVSDVSLSDEGQYTC--SLFTMPVKTSKAYLTVLGVPEKPQISG------ 140

  Fly   206 AGNVESFS----EGNDIVLSCEVSGGRPRPNVTWYLDNTAI-DESFEQRPDGK----TINHLSYP 261
                  ||    ||:.:.|:|:.||.:|..::.|:.::..| |..:.:..|..    |::.....
  Rat   141 ------FSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDF 199

  Fly   262 NVGRQHLNSRLMCVASNTNL-TPPNNRVVILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSK 325
            .|.|......::|...:.:| ..|...:.:|:::..| :|.|:....|....:...:.|:|.|..
  Rat   200 RVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTP-SVKIIPSTPFPQEGQALTLTCESKGKP 263

  Fly   326 PPALITWWKGSKQLKKLTKNFNEPDNQSLSILTFTPGRE---------DDGKYLTCRAENQFIDG 381
            .|..:.|.|...:|.       :||...:|      |||         |:|.| .|.|.|.....
  Rat   264 LPEPVLWTKDGAELP-------DPDRMVVS------GRELNILFLNKTDNGTY-RCEATNTIGQS 314

  Fly   382 SAIEDKWRLIVHYQPTTTL 400
            ||   ::.||||..|.|.|
  Rat   315 SA---EYVLIVHDVPNTLL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 22/109 (20%)
Ig 210..281 CDD:472250 17/79 (22%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 22/83 (27%)
Ig strand C 329..333 CDD:409353 0/3 (0%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Cadm2XP_038944379.1 IgV_1_Necl-3 35..130 CDD:409498 25/112 (22%)
Ig strand A 35..38 CDD:409498 1/1 (100%)
FR1 36..54 CDD:409498 8/17 (47%)
Ig strand A' 39..45 CDD:409498 1/5 (20%)
Ig strand B 47..55 CDD:409498 3/7 (43%)
CDR1 55..60 CDD:409498 0/4 (0%)
FR2 61..68 CDD:409498 1/10 (10%)
Ig strand C 61..67 CDD:409498 1/9 (11%)
CDR2 69..80 CDD:409498 2/11 (18%)
Ig strand C' 71..75 CDD:409498 0/3 (0%)
Ig strand C' 77..80 CDD:409498 1/2 (50%)
FR3 81..116 CDD:409498 9/48 (19%)
Ig strand D 85..92 CDD:409498 2/14 (14%)
Ig strand E 95..101 CDD:409498 0/5 (0%)
Ig strand F 108..116 CDD:409498 4/9 (44%)
CDR3 117..120 CDD:409498 0/2 (0%)
Ig strand G 120..130 CDD:409498 3/9 (33%)
FR4 122..129 CDD:409498 2/6 (33%)
IgI_2_Necl-3 129..232 CDD:409467 25/114 (22%)
Ig strand A 130..133 CDD:409467 0/2 (0%)
Ig strand A' 136..140 CDD:409467 2/3 (67%)
Ig strand B 149..159 CDD:409467 2/9 (22%)
Ig strand C 162..171 CDD:409467 2/8 (25%)
Ig strand C' 172..175 CDD:409467 0/2 (0%)
Ig strand D 177..184 CDD:409467 1/6 (17%)
Ig strand E 190..200 CDD:409467 1/9 (11%)
Ig strand F 208..216 CDD:409467 1/7 (14%)
Ig strand G 224..231 CDD:409467 0/6 (0%)
Ig_3 236..309 CDD:464046 22/87 (25%)
4.1m 397..415 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.