DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and CD200R1L

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001008784.2 Gene:CD200R1L / 344807 HGNCID:24665 Length:271 Species:Homo sapiens


Alignment Length:297 Identity:53/297 - (17%)
Similarity:105/297 - (35%) Gaps:81/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQLLLPLLMLSGISQVC----------STYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISP 97
            |.|:..::|:|..|..|          ||...:.    |:.:||       ::...|:|.|   |
Human     5 RLLISIIIMVSASSSSCMGGKQMTQNYSTIFAEG----NISQPV-------LMDINAVLCC---P 55

  Fly    98 QERDDAVYMVLWFREGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRI 162
            ......:.::.|          ...:||:          |:.  |:|:...|.   :.|..|..:
Human    56 PIALRNLIIITW----------EIILRGQ----------PSC--TKAYKKETN---ETKETNCTV 95

  Fly   163 EDEGVYRCRVDFRNSPTRNLKINLT------------VIVPPDRPVIYGQNRHEKAGNVESFSEG 215
            |       |:.:.:.|.:|..:.:.            ::|.||.....|.:.........:..:.
Human    96 E-------RITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHRGYHLQVLVTPEVNLFQS 153

  Fly   216 NDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQ--------HL-NSR 271
            .:|...|:...|:|...::|..:.:.:....|...:|......:.|..|.:        || .::
Human   154 RNITAVCKAVTGKPAAQISWIPEGSILATKQEYWGNGTVTVKSTCPWEGHKSTVTCHVSHLTGNK 218

  Fly   272 LMCVASNTNL----TPPNNRVVILDVNLKPIAVHILT 304
            .:.|..|:.|    :|..:.::||.|.|....|.::|
Human   219 SLSVKLNSGLRTSGSPALSLLIILYVKLSLFVVILVT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 17/120 (14%)
Ig 210..281 CDD:472250 13/79 (16%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
CD200R1LNP_001008784.2 Ig 37..143 CDD:472250 24/151 (16%)
Ig strand B 50..54 CDD:409353 2/3 (67%)
Ig strand C 64..68 CDD:409353 1/13 (8%)
Ig strand E 108..112 CDD:409353 0/3 (0%)
Ig strand F 122..127 CDD:409353 0/4 (0%)
Ig strand G 135..138 CDD:409353 0/2 (0%)
Ig 147..224 CDD:472250 12/76 (16%)
Ig strand B 156..160 CDD:409500 1/3 (33%)
Ig strand C 170..174 CDD:409500 0/3 (0%)
Ig strand F 206..211 CDD:409500 0/4 (0%)
Ig strand G 219..222 CDD:409500 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.