DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Btn1a1

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001163808.1 Gene:Btn1a1 / 306956 RGDID:1306984 Length:524 Species:Rattus norvegicus


Alignment Length:574 Identity:120/574 - (20%)
Similarity:191/574 - (33%) Gaps:180/574 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PLTTVQGVLGRQAMLPCDISPQERDDAVYMVLWFR--------------EGDGEPIYNFDVRGRQ 127
            |..:|..|:|..|.|.|..||....:.:.: ||||              |.:||.:..:      
  Rat    35 PQESVLAVVGSDAELTCRFSPNASSEQMEL-LWFRQTRSPAVLLYRAGQEQEGEQMTEY------ 92

  Fly   128 FGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPP 192
            .|:|.|.::....|.          |.|:|..:|:.|:|.|||.:. .|..:....::|.|....
  Rat    93 HGRATLVTARLLDGL----------ATLRIRGVRVSDQGQYRCFLK-DNDDSEEAAVHLKVAAVG 146

  Fly   193 DRPVIYGQNRHEKAGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAI--DESFEQRPDGKTI 255
            ..|.|           .....|..|:.|.|..||..|.|.|.|...|..:  ..|..:.||.:.:
  Rat   147 SDPYI-----------SMKVQENGDMELECTSSGWYPEPQVQWRTANREMLPPTSESRNPDTEGL 200

  Fly   256 NHLSYPNVGRQHLNSRLMCVASN------------------TNLTP--PNNRVVILDVNLKPIAV 300
            ..::...:.|.:....:.|...|                  ..|||  ....:|||.:....|..
  Rat   201 FTVTASMMIRDNSIKNMSCCIQNILLGQGKEVEISLPAPFLPRLTPWIVALAIVILALGFLAIGS 265

  Fly   301 HILT-----------KDRFVSADRTY-DVECKSSG-----------SKPPALITWWKGSKQLKKL 342
            ...|           |..|.|.:|.. ::.||.:.           :..|.|.. ::.||.::..
  Rat   266 IFFTWKLYKERSRERKKEFGSKERLLEELRCKKTALHEVDVTLDPDTAHPHLFL-YEDSKSVRLE 329

  Fly   343 TKNFNEPDNQS--------LSILTFTPGR---------EDDGKYLTCRAENQFIDGSAIEDKWRL 390
            ......||...        |...|||.||         ..|.....|| ||....|         
  Rat   330 DSRQILPDRPERFDSWPCVLGRETFTSGRHYWEVEVGDRTDWAIGVCR-ENVVKKG--------- 384

  Fly   391 IVHYQPTTTLKIGSSLNPDD----IKEGDDAYFECIVLANP-----KPYKMSWFHNGKELQHNIS 446
               :.|.|         ||:    ::...:.|:....|..|     .|.::..|     |.:.: 
  Rat   385 ---FDPMT---------PDNGFWAVELYGNGYWALTPLRTPLRLAGPPRRVGVF-----LDYEL- 431

  Fly   447 AGVI----LSDQSLVLQSVSRASAG---DYTCLAVNSEGKGPSNPVTLRIRYAPICATDHEELLG 504
             |.|    :||.||:....|.:.:|   .:.||.  |.||   .|:|:    .|......:..:.
  Rat   432 -GDISFYNMSDGSLIYAFPSISFSGPLRPFFCLW--SCGK---KPLTI----CPTANVPEKITVI 486

  Fly   505 ALKHETLPLKCEVDSSPPADSFQWTFNSSGEQTELPARLHSSETGMSRLNYTPS 558
            |...:.:||      ||..:.     ::||::..|.::|         :.::||
  Rat   487 ANVQDNIPL------SPLGEG-----STSGDKDSLHSKL---------IPFSPS 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 30/122 (25%)
Ig 210..281 CDD:472250 17/90 (19%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 1/3 (33%)
Ig <317..392 CDD:472250 20/102 (20%)
Ig strand C 329..333 CDD:409353 1/3 (33%)
Ig strand E 355..359 CDD:409353 0/3 (0%)
Ig strand F 369..374 CDD:409353 1/4 (25%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 17/79 (22%)
Ig strand B 417..421 CDD:409353 1/3 (33%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 2/3 (67%)
Ig strand F 468..473 CDD:409353 1/4 (25%)
Ig 494..576 CDD:472250 11/65 (17%)
Ig strand B 511..515 CDD:409353 2/3 (67%)
Ig strand C 525..529 CDD:409353 0/3 (0%)
Ig strand E 551..555 CDD:409353 0/3 (0%)
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Btn1a1NP_001163808.1 Ig 30..143 CDD:472250 31/125 (25%)
Ig strand B 47..51 CDD:409353 2/3 (67%)
Ig strand C 63..67 CDD:409353 1/4 (25%)
Ig strand E 108..112 CDD:409353 2/3 (67%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 135..138 CDD:409353 0/2 (0%)
Ig 153..223 CDD:472250 16/69 (23%)
Ig strand B 161..165 CDD:409353 1/3 (33%)
Ig strand C 175..179 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 0/3 (0%)
Ig strand F 216..221 CDD:409353 1/4 (25%)
SPRY_PRY_BTN1_2 304..474 CDD:293991 43/208 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.