DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Nectin3

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_038944117.1 Gene:Nectin3 / 288124 RGDID:1309516 Length:584 Species:Rattus norvegicus


Alignment Length:534 Identity:116/534 - (21%)
Similarity:180/534 - (33%) Gaps:129/534 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KKPTAPHPFPSPNVWRQLLLPLLMLSGISQ------VCSTYVEQDELMQNLDRPVPLTTVQGVLG 86
            |:.|.||..||.  |.:.:.......|...      ..|..||..              |..|.|
  Rat    58 KEKTRPHSKPSQ--WEKSMASCCRSPGAESGQPGALAGSIIVEPH--------------VTAVWG 106

  Fly    87 RQAMLPCDISPQERDDAVYMVLWFR-EGDG-------EPIYNFDVRGRQFGQARLWSSPTAFGTR 143
            :...|.|.|   |.::.:..:.|.: .|..       .|.|.|.|:|...|             |
  Rat   107 KNVSLKCLI---EVNETITQISWEKIHGKSTQTVAVHHPQYGFSVQGEYQG-------------R 155

  Fly   144 AHFSS-TTHPAQLKIDNIRIEDEGVYRCR-VDFRNSPTRNLK--INLTVIVPPDRPVIYGQNRHE 204
            ..|.: :.:.|.:.:.||...|.|.|.|: |.|   |..|.:  ..:||:|.|...::.|.:...
  Rat   156 ILFKNYSLNDATITLHNIGFSDSGKYICKAVTF---PLGNAQSSTTVTVLVEPTVSLMKGPDSLI 217

  Fly   205 KAGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLS----YPNVGR 265
            ..||       ..:...|..:.|:|...:.|..|...::.:....|: :|...:|    :|.  |
  Rat   218 DGGN-------ETVAAVCIAATGKPVARIDWEGDLGEMESTITSFPN-ETATIISQYKLFPT--R 272

  Fly   266 QHLNSRLMCVASNTNLTPPNNRVVILDVNLKP-IAVHILTKDRFVSADRTYDVECKSSGSKPPAL 329
            .....|:.||..:..|........|||:...| ::|.....:.||.. :..:::|.:..:.||..
  Rat   273 FARGRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNWFVGR-KGVNLKCNADANPPPFK 336

  Fly   330 ITW------WKGSKQLKKLTKNFNEPDNQSLSILTFTPGREDDGKYLTCRAENQFIDGSAIEDKW 388
            ..|      |.........|.:|..|       |||    ...|.|: |:..|.....|   |:.
  Rat   337 SVWSRLDGEWPDGLLASDNTLHFVHP-------LTF----NYSGVYV-CKVTNSLGQRS---DQK 386

  Fly   389 RLIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPK-PYKMSWFHNGK-ELQHNISAGVIL 451
            .:.:...||||     :|.|........|..:.:...:.| |:.:|.....| :....|.|.|:.
  Rat   387 VIYISDPPTTT-----TLQPTVQWRSSTADVQDLATEHKKLPFPLSTLATLKDDTIGTIIASVVG 446

  Fly   452 SDQSLVLQSV---------SRASAGDYTCLAVNSEGKGPSNPVTLRIRYAPICATDHEELLGALK 507
            ....:||.|:         .|...|||  .|.|               |.|......|..:..|:
  Rat   447 GALFVVLVSILAGVFCYRRRRTFRGDY--FAKN---------------YIPPSDMQKESQIDVLQ 494

  Fly   508 HETLPLKCEVDSSP 521
            |:      |.||.|
  Rat   495 HD------EHDSYP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 28/120 (23%)
Ig 210..281 CDD:472250 13/74 (18%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 17/80 (21%)
Ig strand C 329..333 CDD:409353 1/9 (11%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 1/2 (50%)
Ig 411..479 CDD:472250 17/78 (22%)
Ig strand B 417..421 CDD:409353 1/3 (33%)
Ig strand C 431..435 CDD:409353 1/3 (33%)
Ig strand E 454..458 CDD:409353 0/3 (0%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 7/28 (25%)
Ig strand B 511..515 CDD:409353 0/3 (0%)
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Nectin3XP_038944117.1 IgV_1_Nectin-3_like 93..202 CDD:409470 32/141 (23%)
FR1 93..116 CDD:409470 9/39 (23%)
Ig strand A 93..97 CDD:409470 1/3 (33%)
Ig strand A' 99..103 CDD:409470 1/17 (6%)
Ig strand B 108..116 CDD:409470 3/10 (30%)
CDR1 117..121 CDD:409470 0/3 (0%)
FR2 122..128 CDD:409470 1/5 (20%)
Ig strand C 123..128 CDD:409470 1/4 (25%)
CDR2 129..148 CDD:409470 4/18 (22%)
Ig strand C' 138..143 CDD:409470 0/4 (0%)
Ig strand C' 145..149 CDD:409470 1/3 (33%)
FR3 149..187 CDD:409470 11/50 (22%)
Ig strand D 156..160 CDD:409470 1/3 (33%)
Ig strand E 165..172 CDD:409470 1/6 (17%)
Ig strand F 179..187 CDD:409470 3/7 (43%)
CDR3 188..191 CDD:409470 2/5 (40%)
Ig strand G 191..201 CDD:409470 1/9 (11%)
FR4 192..202 CDD:409470 2/9 (22%)
IgC1_2_Nectin-3-4_like 205..300 CDD:409501 20/104 (19%)
Ig strand A 205..211 CDD:409501 1/5 (20%)
Ig strand B 224..231 CDD:409501 1/6 (17%)
Ig strand C 236..242 CDD:409501 0/5 (0%)
Ig strand C' 244..246 CDD:409501 1/1 (100%)
Ig strand D 248..255 CDD:409501 0/6 (0%)
Ig strand E 260..268 CDD:409501 1/7 (14%)
Ig strand F 278..285 CDD:409501 3/6 (50%)
Ig strand G 291..297 CDD:409501 0/5 (0%)
Ig 304..390 CDD:472250 21/101 (21%)
Ig strand B 322..326 CDD:409353 0/3 (0%)
Ig strand C 336..340 CDD:409353 0/3 (0%)
Ig strand E 355..360 CDD:409353 1/4 (25%)
Ig strand F 370..375 CDD:409353 2/5 (40%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
TM_EGFR-like 438..467 CDD:213052 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.