DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Cd200r2

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_996258.1 Gene:Cd200r2 / 271375 MGIID:3042847 Length:249 Species:Mus musculus


Alignment Length:249 Identity:56/249 - (22%)
Similarity:99/249 - (39%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TTVQGVLGRQAMLPCDISPQERDDAVYMVLWFREGDGEP--IYNFDVRGRQFGQARLWSSPTAFG 141
            |.|...:|.:|.|.|...|..:   ..::.|..:..|:|  |..:.|..::       ::.|..|
Mouse    24 TIVSVQMGTKARLCCRSIPLTK---AVLITWIIKPRGQPSCIMAYKVETKE-------TNETCLG 78

  Fly   142 TRAHFSST-THPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNL-KI-NLTVIVPPDRPVIYGQNRH 203
            ....::|| .|...|:|..:.::.||.|.|.:   .:|..|. |: :|.|:|||:.....|:|| 
Mouse    79 RNITWASTPDHIPDLQISAVALQHEGNYLCEI---TTPEGNFHKVYDLQVLVPPEVTYFLGENR- 139

  Fly   204 EKAGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDG----KTINHLSYPNVG 264
                           ...||...|:|...::|..|...:.:| |...:|    ::..|....|| 
Mouse   140 ---------------TAVCEAMAGKPAAQISWTPDGDCVTKS-ESHSNGTVTVRSTCHWEQNNV- 187

  Fly   265 RQHLNSRLMCVASN---------------TNLTPPNNRVVILDVNLKPIAVHIL 303
                 |.:.|:.|:               |:.||  :.:.||.|.:..:.:.:|
Mouse   188 -----SAVSCIVSHSTGNQSLSIELSRGTTSTTP--SLLTILYVKMVLLGIILL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 27/113 (24%)
Ig 210..281 CDD:472250 16/89 (18%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Cd200r2NP_996258.1 IgV_CD200R-like 20..126 CDD:409577 27/114 (24%)
FR1 20..38 CDD:409577 5/13 (38%)
Ig strand A 20..26 CDD:409577 1/1 (100%)
Ig strand A' 28..30 CDD:409577 0/1 (0%)
Ig strand B 32..39 CDD:409577 2/6 (33%)
CDR1 39..47 CDD:409577 1/10 (10%)
Ig strand C 47..55 CDD:409577 1/7 (14%)
FR2 48..56 CDD:409577 1/7 (14%)
CDR2 57..75 CDD:409577 4/24 (17%)
Ig strand C' 61..66 CDD:409577 1/4 (25%)
Ig strand C' 70..75 CDD:409577 0/11 (0%)
FR3 76..112 CDD:409577 10/38 (26%)
Ig strand D 80..85 CDD:409577 0/4 (0%)
Ig strand E 90..97 CDD:409577 2/6 (33%)
Ig strand F 104..112 CDD:409577 3/10 (30%)
CDR3 113..115 CDD:409577 1/1 (100%)
FR4 116..126 CDD:409577 3/9 (33%)
Ig strand G 116..126 CDD:409577 3/9 (33%)
Ig 141..208 CDD:472250 15/73 (21%)
Ig strand C 153..156 CDD:409353 0/2 (0%)
Ig strand F 188..194 CDD:409353 2/5 (40%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.