DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Mog

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_006255929.1 Gene:Mog / 24558 RGDID:3102 Length:264 Species:Rattus norvegicus


Alignment Length:151 Identity:38/151 - (25%)
Similarity:60/151 - (39%) Gaps:50/151 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VWRQLLLP--LLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDA 103
            || .|.||  ||.|..:.|:..:|..|..::.      |...::.::|.:|.|||.|||.:  :|
  Rat     4 VW-SLSLPSCLLSLLLLLQLSCSYAGQFRVIG------PGHPIRALVGDEAELPCRISPGK--NA 59

  Fly   104 VYM-VLWFREGDGEPIYNF------------DVRGR------QFGQARLWSSPTAFGTRAHFSST 149
            ..| |.|:|......::.:            :.|||      ..|:.::                
  Rat    60 TGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKV---------------- 108

  Fly   150 THPAQLKIDNIRIEDEGVYRC 170
                .|:|.|:|..|||.|.|
  Rat   109 ----ALRIQNVRFSDEGGYTC 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 26/111 (23%)
Ig 210..281 CDD:472250
Ig strand B 218..222 CDD:409353
Ig strand C 232..236 CDD:409353
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
MogXP_006255929.1 IgV_MOG_like 30..142 CDD:409378 27/124 (22%)
FR1 30..53 CDD:409378 6/28 (21%)
Ig strand A 31..35 CDD:409378 0/9 (0%)
Ig strand A' 38..42 CDD:409378 0/3 (0%)
Ig strand B 45..53 CDD:409378 4/7 (57%)
CDR1 54..62 CDD:409378 3/9 (33%)
Ig strand C 62..67 CDD:409378 2/4 (50%)
FR2 63..67 CDD:409378 1/3 (33%)
CDR2 68..86 CDD:409378 1/17 (6%)
Ig strand C' 72..80 CDD:409378 0/7 (0%)
Ig strand C' 81..84 CDD:409378 0/2 (0%)
FR3 88..128 CDD:409378 13/58 (22%)
Ig strand D 95..100 CDD:409378 1/4 (25%)
Ig strand E 106..114 CDD:409378 2/27 (7%)
Ig strand F 121..129 CDD:409378 3/5 (60%)
CDR3 129..131 CDD:409378
Ig strand G 131..142 CDD:409378
FR4 132..142 CDD:409378
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.