| Sequence 1: | NP_001034052.2 | Gene: | side-IV / 41657 | FlyBaseID: | FBgn0038156 | Length: | 1001 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006255929.1 | Gene: | Mog / 24558 | RGDID: | 3102 | Length: | 264 | Species: | Rattus norvegicus |
| Alignment Length: | 151 | Identity: | 38/151 - (25%) |
|---|---|---|---|
| Similarity: | 60/151 - (39%) | Gaps: | 50/151 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 VWRQLLLP--LLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDA 103
Fly 104 VYM-VLWFREGDGEPIYNF------------DVRGR------QFGQARLWSSPTAFGTRAHFSST 149
Fly 150 THPAQLKIDNIRIEDEGVYRC 170 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| side-IV | NP_001034052.2 | V-set | 79..188 | CDD:462230 | 26/111 (23%) |
| Ig | 210..281 | CDD:472250 | |||
| Ig strand B | 218..222 | CDD:409353 | |||
| Ig strand C | 232..236 | CDD:409353 | |||
| Ig | <317..392 | CDD:472250 | |||
| Ig strand C | 329..333 | CDD:409353 | |||
| Ig strand E | 355..359 | CDD:409353 | |||
| Ig strand F | 369..374 | CDD:409353 | |||
| Ig strand G | 385..388 | CDD:409353 | |||
| Ig | 411..479 | CDD:472250 | |||
| Ig strand B | 417..421 | CDD:409353 | |||
| Ig strand C | 431..435 | CDD:409353 | |||
| Ig strand E | 454..458 | CDD:409353 | |||
| Ig strand F | 468..473 | CDD:409353 | |||
| Ig | 494..576 | CDD:472250 | |||
| Ig strand B | 511..515 | CDD:409353 | |||
| Ig strand C | 525..529 | CDD:409353 | |||
| Ig strand E | 551..555 | CDD:409353 | |||
| Ig strand F | 566..570 | CDD:409353 | |||
| fn3 | 593..675 | CDD:394996 | |||
| Mog | XP_006255929.1 | IgV_MOG_like | 30..142 | CDD:409378 | 27/124 (22%) |
| FR1 | 30..53 | CDD:409378 | 6/28 (21%) | ||
| Ig strand A | 31..35 | CDD:409378 | 0/9 (0%) | ||
| Ig strand A' | 38..42 | CDD:409378 | 0/3 (0%) | ||
| Ig strand B | 45..53 | CDD:409378 | 4/7 (57%) | ||
| CDR1 | 54..62 | CDD:409378 | 3/9 (33%) | ||
| Ig strand C | 62..67 | CDD:409378 | 2/4 (50%) | ||
| FR2 | 63..67 | CDD:409378 | 1/3 (33%) | ||
| CDR2 | 68..86 | CDD:409378 | 1/17 (6%) | ||
| Ig strand C' | 72..80 | CDD:409378 | 0/7 (0%) | ||
| Ig strand C' | 81..84 | CDD:409378 | 0/2 (0%) | ||
| FR3 | 88..128 | CDD:409378 | 13/58 (22%) | ||
| Ig strand D | 95..100 | CDD:409378 | 1/4 (25%) | ||
| Ig strand E | 106..114 | CDD:409378 | 2/27 (7%) | ||
| Ig strand F | 121..129 | CDD:409378 | 3/5 (60%) | ||
| CDR3 | 129..131 | CDD:409378 | |||
| Ig strand G | 131..142 | CDD:409378 | |||
| FR4 | 132..142 | CDD:409378 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||