DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Cd200r4

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_997127.1 Gene:Cd200r4 / 239849 MGIID:3036289 Length:270 Species:Mus musculus


Alignment Length:285 Identity:67/285 - (23%)
Similarity:115/285 - (40%) Gaps:67/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLG----RQAMLPCDISPQERDDAVYMV 107
            |.||:...|....|:..::::.:|| |....||.|...:.    ::|:|.|..||  ..:|| ::
Mouse    10 LTLLIFINIFVSGSSCTDENQTIQN-DSSSSLTQVNTTMSVQMDKKALLCCFSSP--LINAV-LI 70

  Fly   108 LWFREGDGEP----IYNFDVRGRQ---FGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIEDE 165
            .|..:....|    .||.|.:..:   .|:...|:           |:..|..:|:|..:.::.|
Mouse    71 TWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWA-----------STPDHSPELQISAVALQHE 124

  Fly   166 GVYRCRVDFRNSPTRNLK--INLTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLSCEVSGGR 228
            |.|.|.:   .:|..||:  .:|.|:|||:.....|:||                ...||...|:
Mouse   125 GTYTCEI---VTPEGNLEKVYDLQVLVPPEVTYFPGKNR----------------TAVCEAMAGK 170

  Fly   229 PRPNVTWYLDNTAIDESFEQRPDG----KTINHLSYPNV-----------GRQHLNSRLMCVASN 278
            |...::|..|...:.:| |...:|    ::..|....||           |.|.|:..|    |.
Mouse   171 PAAQISWTPDGDCVTKS-ESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIEL----SQ 230

  Fly   279 TNLTPPNNRVVILDVNLKPIAVHIL 303
            ..:|.|.:.:.||.|.:..:.:.:|
Mouse   231 GTMTTPRSLLTILYVKMALLVIILL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 28/121 (23%)
Ig 210..281 CDD:472250 17/85 (20%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Cd200r4NP_997127.1 IgV_CD200R-like 41..147 CDD:409577 28/122 (23%)
FR1 41..59 CDD:409577 4/17 (24%)
Ig strand A 41..47 CDD:409577 2/5 (40%)
Ig strand A' 49..51 CDD:409577 0/1 (0%)
Ig strand B 53..60 CDD:409577 2/6 (33%)
CDR1 60..68 CDD:409577 2/9 (22%)
Ig strand C 68..76 CDD:409577 2/8 (25%)
FR2 69..77 CDD:409577 1/7 (14%)
CDR2 78..96 CDD:409577 4/17 (24%)
Ig strand C' 82..87 CDD:409577 0/4 (0%)
Ig strand C' 91..96 CDD:409577 0/4 (0%)
FR3 97..133 CDD:409577 10/49 (20%)
Ig strand D 101..106 CDD:409577 1/15 (7%)
Ig strand E 111..118 CDD:409577 2/6 (33%)
Ig strand F 125..133 CDD:409577 3/10 (30%)
CDR3 134..136 CDD:409577 1/1 (100%)
FR4 137..147 CDD:409577 3/9 (33%)
Ig strand G 137..147 CDD:409577 3/9 (33%)
Ig 162..230 CDD:472250 16/72 (22%)
Ig strand C 174..177 CDD:409500 0/2 (0%)
Ig strand F 209..215 CDD:409500 0/5 (0%)
Ig strand G 223..226 CDD:409500 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.