DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and ALCAM

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001618.2 Gene:ALCAM / 214 HGNCID:400 Length:583 Species:Homo sapiens


Alignment Length:492 Identity:105/492 - (21%)
Similarity:169/492 - (34%) Gaps:170/492 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 RPNVTWYLDNTAIDESF------------------EQRPDG---------KTINHLSYPNVG--R 265
            ||.:.||..|:|..::.                  .::|||         .|...:.|.:|.  :
Human    23 RPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYK 87

  Fly   266 QHLNSRLMCVASNTNLTPPNNRV--------------------VILDVNLKPIAVHILTKDRFVS 310
            ..||     ::.|..|:..|.|:                    .|:.|..:|....|::|..|:.
Human    88 DRLN-----LSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFKQPSKPEIVSKALFLE 147

  Fly   311 ADRTYDV-ECKSSGSKPPALITWWKGSKQLKKLT-------KNFNEPDNQ---SLSILTFTPGRE 364
            .::...: :|.|..|.|...|||::..|.|..|.       |...:|..|   ..|.|.:...:.
Human   148 TEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKA 212

  Fly   365 DDGKYLTCRAENQFIDG-SAIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPK 428
            |.....||........| ..|..:..:...|.||..:.|......:.|||||:...:|:...||.
Human   213 DIQMPFTCSVTYYGPSGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPP 277

  Fly   429 PYKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTC--------------------LA 473
            |.:..::..|:      ..| |.|..:..|..|.|.:.|||.|                    |:
Human   278 PEEFLFYLPGQ------PEG-IRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLS 335

  Fly   474 VNSEGK-----GPSNPVT-----------------LRIRYAP-------------ICATDHEELL 503
            :|..|:     |.:.||:                 :|:|.:|             :|.|..:|:.
Human   336 LNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVE 400

  Fly   504 GALKHETLPL-----------------------KCEVDSSP-PADSFQWTFNSSG---EQTE--- 538
            |..|.|:|.|                       .|.|:..| ||  .|||...||   .|||   
Human   401 GLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHVEGFPKPA--IQWTITGSGSVINQTEESP 463

  Fly   539 -LPARLHSSETGMSRLNYTPSTDLDYGTISCWAKNSI 574
             :..|.:      |::..:|..::   |::|.|:|.:
Human   464 YINGRYY------SKIIISPEENV---TLTCTAENQL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230
Ig 210..281 CDD:472250 15/79 (19%)
Ig strand B 218..222 CDD:409353
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 20/86 (23%)
Ig strand C 329..333 CDD:409353 2/3 (67%)
Ig strand E 355..359 CDD:409353 2/3 (67%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 22/87 (25%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 0/3 (0%)
Ig strand F 468..473 CDD:409353 3/24 (13%)
Ig 494..576 CDD:472250 28/112 (25%)
Ig strand B 511..515 CDD:409353 2/26 (8%)
Ig strand C 525..529 CDD:409353 1/3 (33%)
Ig strand E 551..555 CDD:409353 1/3 (33%)
Ig strand F 566..570 CDD:409353 1/3 (33%)
fn3 593..675 CDD:394996
ALCAMNP_001618.2 IGv 38..113 CDD:214650 12/79 (15%)
Ig strand B 39..43 CDD:409353 0/3 (0%)
Ig strand C 55..59 CDD:409353 0/3 (0%)
Ig strand E 96..100 CDD:409353 1/3 (33%)
Ig strand F 110..115 CDD:409353 0/4 (0%)
C2-set_2 137..231 CDD:400489 22/93 (24%)
Ig strand B 143..157 CDD:409353 1/13 (8%)
Ig strand C 167..171 CDD:409353 2/3 (67%)
Ig strand E 203..207 CDD:409353 2/3 (67%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
IG_like 255..329 CDD:214653 20/80 (25%)
Ig strand B 266..270 CDD:409353 0/3 (0%)
Ig strand C 280..284 CDD:409353 0/3 (0%)
Ig strand E 296..300 CDD:409353 0/3 (0%)
IG_like 339..393 CDD:214653 7/53 (13%)
Ig strand C 363..367 CDD:409353 0/3 (0%)
Ig strand F 389..393 CDD:409353 0/3 (0%)
Ig_3 415..489 CDD:464046 19/84 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 562..583
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.