DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Skint3

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001095944.1 Gene:Skint3 / 195564 MGIID:3045331 Length:458 Species:Mus musculus


Alignment Length:290 Identity:61/290 - (21%)
Similarity:103/290 - (35%) Gaps:94/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDAVYM-VLW 109
            :|.:|:||          .:...:..|:||| |..:.|:|    .|.|.:||.:  :|..| :.|
Mouse    17 VLQMLVLS----------SEQFTITGLERPV-LAPLGGIL----ELSCQLSPPQ--NAQQMEIRW 64

  Fly   110 FREGDGEPIYNF----DVRGRQFGQARLWSSPTAFGTRAHFSSTTH---------PAQLKIDNIR 161
            ||....||:|.:    |:.|.               |.:.:...|.         ...|::..:.
Mouse    65 FRNRYTEPVYLYRNGKDLHGE---------------TISKYVERTELLKHDIGKGKVTLRVFKVT 114

  Fly   162 IEDEGVYRCRVD---FRNSPTRNLKINLT-----VIVPPDRPVIYGQNRHEKAGNVESFSEGNDI 218
            ::|:|.|.|...   |.......:|:..|     :|:.|  |.|.|                  :
Mouse   115 VDDDGSYHCVFKDGIFYEEHITEVKVTATSSDIKIIMHP--PNIKG------------------V 159

  Fly   219 VLSCEVSGGRPRPNVTWYLDNTAI---DESFEQRPDGKTINHLS--YPNVGRQHLNSRLMCVASN 278
            :|.|...|..|:|::.|...|..:   ....:.:.:.|..|...  :.:||   |:..:.|...|
Mouse   160 MLECHSRGWFPQPHMEWRDSNGQVIPATSKSQSQDENKLFNMTMNLFADVG---LHQIVTCYIQN 221

  Fly   279 TNLTPPNNRVVILDVNLKPIAVHILTKDRF 308
            . ||.....:.|           :||.|.|
Mouse   222 L-LTHQEESISI-----------VLTGDLF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 26/130 (20%)
Ig 210..281 CDD:472250 14/75 (19%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Skint3NP_001095944.1 Ig 28..141 CDD:472250 30/134 (22%)
Ig strand B 45..49 CDD:409353 2/7 (29%)
Ig strand C 61..65 CDD:409353 0/3 (0%)
Ig strand E 106..110 CDD:409353 1/3 (33%)
Ig strand F 120..125 CDD:409353 2/4 (50%)
Ig 130..220 CDD:472250 21/112 (19%)
Ig strand G 133..136 CDD:409353 0/2 (0%)
Ig strand B 148..163 CDD:409353 6/34 (18%)
Ig strand C 173..177 CDD:409353 0/3 (0%)
Ig strand F 213..219 CDD:409353 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.