DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Nectin1

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001093946.1 Gene:Nectin1 / 192183 RGDID:620791 Length:515 Species:Rattus norvegicus


Alignment Length:449 Identity:80/449 - (17%)
Similarity:142/449 - (31%) Gaps:157/449 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TVQGVLGRQAMLPCDISPQERDDAVYMVLWFREGDGE----PIYNFDVRGRQFGQARLWSSPT-- 138
            ::.|.:|...:|.|..:.......:..|.|.:..:|.    .|||                ||  
  Rat    38 SMYGFIGTDVILHCSFANPLPTVKITQVTWQKASNGSKQNMAIYN----------------PTMG 86

  Fly   139 -----AFGTRAHFSSTTH-PAQLKIDNIRIEDEGVYRCRVDFRNSPT--RNLKINLTVIVPPDRP 195
                 .:..|..|...:. ...:::.::.:||||:|.|  :|...||  |..::||||:..|   
  Rat    87 VSVLPPYEKRVEFLRPSFIDGTIRLSHLELEDEGMYIC--EFATFPTGNRESQLNLTVMAKP--- 146

  Fly   196 VIYGQNRHEKAGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSY 260
                          .::.||...||                                        
  Rat   147 --------------TNWIEGTQAVL---------------------------------------- 157

  Fly   261 PNVGRQHLNSRLMCVASNTNLTPPNNRVVILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSK 325
                                                        :.|....|:.....|.|:..|
  Rat   158 --------------------------------------------RARKGQDDKVLVATCTSANGK 178

  Fly   326 PPALITW---WKGSKQLKKLTKNFNEPDNQSLSILT---FTPGREDDGKYLTCRAENQFIDGSAI 384
            ||::::|   .||..:.:::..     .|.::::::   ..|.||...:.|.| ..|..:|  ..
  Rat   179 PPSVVSWETRLKGEAEYQEIRN-----PNGTVTVISRYRLVPSREAHRQSLAC-IVNYHLD--RF 235

  Fly   385 EDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGV 449
            .:...|.|.|:|..|::   ..:.:...:..|....|...|||...:..|    ..|..::..||
  Rat   236 RESLTLNVQYEPEVTIE---GFDGNWYLQRTDVKLTCKADANPPATEYHW----TTLNGSLPKGV 293

  Fly   450 ILSDQSLVLQS-VSRASAGDYTCLAVNSEGKGPSNPVTLRIRYAPICAT-DHEELLGAL 506
            ...:::|..:. ::.:.||.|.|.|.|..|. .|..|.:.|...|...| :|....|.:
  Rat   294 EAQNRTLFFRGPINYSLAGTYICEATNPIGT-RSGQVEVNITEFPYTPTPEHGRRAGQM 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 26/121 (21%)
Ig 210..281 CDD:472250 4/70 (6%)
Ig strand B 218..222 CDD:409353 2/3 (67%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 17/80 (21%)
Ig strand C 329..333 CDD:409353 1/6 (17%)
Ig strand E 355..359 CDD:409353 0/6 (0%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 16/68 (24%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 3/14 (21%)
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
Nectin1NP_001093946.1 IgV_1_Nectin-1_like 31..143 CDD:409469 27/122 (22%)
FR1 31..54 CDD:409469 4/15 (27%)
Ig strand A 31..35 CDD:409469
Ig strand A' 37..41 CDD:409469 0/2 (0%)
Ig strand B 46..54 CDD:409469 2/7 (29%)
CDR1 55..62 CDD:409469 0/6 (0%)
FR2 63..69 CDD:409469 2/5 (40%)
Ig strand C 64..69 CDD:409469 2/4 (50%)
CDR2 70..89 CDD:409469 6/34 (18%)
Ig strand C' 79..84 CDD:409469 3/20 (15%)
Ig strand C' 86..90 CDD:409469 0/3 (0%)
FR3 90..128 CDD:409469 9/39 (23%)
Ig strand D 97..101 CDD:409469 1/3 (33%)
Ig strand E 106..113 CDD:409469 0/6 (0%)
Ig strand F 120..128 CDD:409469 4/9 (44%)
CDR3 129..132 CDD:409469 1/2 (50%)
Ig strand G 132..142 CDD:409469 3/9 (33%)
FR4 133..143 CDD:409469 4/9 (44%)
IgC1_2_Nectin-1_like 146..243 CDD:143298 24/205 (12%)
Ig strand A 146..152 CDD:143298 1/22 (5%)
Ig strand B 168..175 CDD:143298 1/6 (17%)
Ig strand C 180..186 CDD:143298 1/5 (20%)
Ig strand C' 188..190 CDD:143298 0/1 (0%)
Ig strand D 191..199 CDD:143298 1/7 (14%)
Ig strand E 205..213 CDD:143298 0/7 (0%)
Ig strand F 223..230 CDD:143298 2/7 (29%)
Ig strand G 234..240 CDD:143298 0/5 (0%)
Ig 247..333 CDD:472250 21/93 (23%)
Ig strand B 265..269 CDD:409353 0/3 (0%)
Ig strand C 279..283 CDD:409353 1/7 (14%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
Ig strand G 330..333 CDD:409353 0/2 (0%)
TM_EGFR-like 353..382 CDD:213052
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.