DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Mog

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_034944.2 Gene:Mog / 17441 MGIID:97435 Length:247 Species:Mus musculus


Alignment Length:152 Identity:40/152 - (26%)
Similarity:60/152 - (39%) Gaps:48/152 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FPSPNVWRQLLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQER 100
            |..|:.:..|||.||:     |:..:|..|..::.      |...::.::|.:|.|||.|||.: 
Mouse     7 FSWPSCFLSLLLLLLL-----QLSCSYAGQFRVIG------PGYPIRALVGDEAELPCRISPGK- 59

  Fly   101 DDAVYM-VLWFR--------------EGDGE--PIYNFDVRGRQFGQARLWSSPTAFGTRAHFSS 148
             :|..| |.|:|              :.|.|  |.|.        |:..|.....:.|       
Mouse    60 -NATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYR--------GRTELLKETISEG------- 108

  Fly   149 TTHPAQLKIDNIRIEDEGVYRC 170
               ...|:|.|:|..|||.|.|
Mouse   109 ---KVTLRIQNVRFSDEGGYTC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 29/109 (27%)
Ig 210..281 CDD:472250
Ig strand B 218..222 CDD:409353
Ig strand C 232..236 CDD:409353
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
MogNP_034944.2 IgV_MOG_like 32..144 CDD:409378 30/122 (25%)
FR1 32..55 CDD:409378 6/28 (21%)
Ig strand A 33..37 CDD:409378 0/9 (0%)
Ig strand A' 40..44 CDD:409378 0/3 (0%)
Ig strand B 47..55 CDD:409378 4/7 (57%)
CDR1 56..64 CDD:409378 3/9 (33%)
Ig strand C 64..69 CDD:409378 2/4 (50%)
FR2 65..69 CDD:409378 1/3 (33%)
CDR2 70..88 CDD:409378 1/17 (6%)
Ig strand C' 74..82 CDD:409378 0/7 (0%)
Ig strand C' 83..86 CDD:409378 0/2 (0%)
FR3 90..130 CDD:409378 14/56 (25%)
Ig strand D 97..102 CDD:409378 1/4 (25%)
Ig strand E 108..116 CDD:409378 3/17 (18%)
Ig strand F 123..131 CDD:409378 3/5 (60%)
CDR3 131..133 CDD:409378
Ig strand G 133..144 CDD:409378
FR4 134..144 CDD:409378
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.