| Sequence 1: | NP_001034052.2 | Gene: | side-IV / 41657 | FlyBaseID: | FBgn0038156 | Length: | 1001 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_034944.2 | Gene: | Mog / 17441 | MGIID: | 97435 | Length: | 247 | Species: | Mus musculus |
| Alignment Length: | 152 | Identity: | 40/152 - (26%) |
|---|---|---|---|
| Similarity: | 60/152 - (39%) | Gaps: | 48/152 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 36 FPSPNVWRQLLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQER 100
Fly 101 DDAVYM-VLWFR--------------EGDGE--PIYNFDVRGRQFGQARLWSSPTAFGTRAHFSS 148
Fly 149 TTHPAQLKIDNIRIEDEGVYRC 170 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| side-IV | NP_001034052.2 | V-set | 79..188 | CDD:462230 | 29/109 (27%) |
| Ig | 210..281 | CDD:472250 | |||
| Ig strand B | 218..222 | CDD:409353 | |||
| Ig strand C | 232..236 | CDD:409353 | |||
| Ig | <317..392 | CDD:472250 | |||
| Ig strand C | 329..333 | CDD:409353 | |||
| Ig strand E | 355..359 | CDD:409353 | |||
| Ig strand F | 369..374 | CDD:409353 | |||
| Ig strand G | 385..388 | CDD:409353 | |||
| Ig | 411..479 | CDD:472250 | |||
| Ig strand B | 417..421 | CDD:409353 | |||
| Ig strand C | 431..435 | CDD:409353 | |||
| Ig strand E | 454..458 | CDD:409353 | |||
| Ig strand F | 468..473 | CDD:409353 | |||
| Ig | 494..576 | CDD:472250 | |||
| Ig strand B | 511..515 | CDD:409353 | |||
| Ig strand C | 525..529 | CDD:409353 | |||
| Ig strand E | 551..555 | CDD:409353 | |||
| Ig strand F | 566..570 | CDD:409353 | |||
| fn3 | 593..675 | CDD:394996 | |||
| Mog | NP_034944.2 | IgV_MOG_like | 32..144 | CDD:409378 | 30/122 (25%) |
| FR1 | 32..55 | CDD:409378 | 6/28 (21%) | ||
| Ig strand A | 33..37 | CDD:409378 | 0/9 (0%) | ||
| Ig strand A' | 40..44 | CDD:409378 | 0/3 (0%) | ||
| Ig strand B | 47..55 | CDD:409378 | 4/7 (57%) | ||
| CDR1 | 56..64 | CDD:409378 | 3/9 (33%) | ||
| Ig strand C | 64..69 | CDD:409378 | 2/4 (50%) | ||
| FR2 | 65..69 | CDD:409378 | 1/3 (33%) | ||
| CDR2 | 70..88 | CDD:409378 | 1/17 (6%) | ||
| Ig strand C' | 74..82 | CDD:409378 | 0/7 (0%) | ||
| Ig strand C' | 83..86 | CDD:409378 | 0/2 (0%) | ||
| FR3 | 90..130 | CDD:409378 | 14/56 (25%) | ||
| Ig strand D | 97..102 | CDD:409378 | 1/4 (25%) | ||
| Ig strand E | 108..116 | CDD:409378 | 3/17 (18%) | ||
| Ig strand F | 123..131 | CDD:409378 | 3/5 (60%) | ||
| CDR3 | 131..133 | CDD:409378 | |||
| Ig strand G | 133..144 | CDD:409378 | |||
| FR4 | 134..144 | CDD:409378 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||