| Sequence 1: | NP_001034052.2 | Gene: | side-IV / 41657 | FlyBaseID: | FBgn0038156 | Length: | 1001 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_311453.2 | Gene: | LOC1272537 / 1272537 | VectorBaseID: | AGAMI1_004034 | Length: | 144 | Species: | Anopheles gambiae |
| Alignment Length: | 141 | Identity: | 33/141 - (23%) |
|---|---|---|---|
| Similarity: | 53/141 - (37%) | Gaps: | 24/141 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 55 ISQVCSTYV-EQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDAVYMVLWFREGDGEPI 118
Fly 119 YNFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRVD--FRNSPTRN 181
Fly 182 LKINLTVIVPP 192 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| side-IV | NP_001034052.2 | V-set | 79..188 | CDD:462230 | 22/110 (20%) |
| Ig | 210..281 | CDD:472250 | |||
| Ig strand B | 218..222 | CDD:409353 | |||
| Ig strand C | 232..236 | CDD:409353 | |||
| Ig | <317..392 | CDD:472250 | |||
| Ig strand C | 329..333 | CDD:409353 | |||
| Ig strand E | 355..359 | CDD:409353 | |||
| Ig strand F | 369..374 | CDD:409353 | |||
| Ig strand G | 385..388 | CDD:409353 | |||
| Ig | 411..479 | CDD:472250 | |||
| Ig strand B | 417..421 | CDD:409353 | |||
| Ig strand C | 431..435 | CDD:409353 | |||
| Ig strand E | 454..458 | CDD:409353 | |||
| Ig strand F | 468..473 | CDD:409353 | |||
| Ig | 494..576 | CDD:472250 | |||
| Ig strand B | 511..515 | CDD:409353 | |||
| Ig strand C | 525..529 | CDD:409353 | |||
| Ig strand E | 551..555 | CDD:409353 | |||
| Ig strand F | 566..570 | CDD:409353 | |||
| fn3 | 593..675 | CDD:394996 | |||
| LOC1272537 | XP_311453.2 | IG_like | 38..130 | CDD:214653 | 23/112 (21%) |
| Ig strand B | 49..53 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 61..65 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 94..98 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 108..113 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||