DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and LOC1272537

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_311453.2 Gene:LOC1272537 / 1272537 VectorBaseID:AGAMI1_004034 Length:144 Species:Anopheles gambiae


Alignment Length:141 Identity:33/141 - (23%)
Similarity:53/141 - (37%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ISQVCSTYV-EQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDAVYMVLWFREGDGEPI 118
            ::.||..|| ..|...|...|..| ..::...|.:.:|.|:|     :.....|.|.::|     
Mosquito    15 VTAVCGRYVTSTDAEPQQTFRITP-NDIEANQGDEVVLRCEI-----EHLAGRVQWTKDG----- 68

  Fly   119 YNFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRVD--FRNSPTRN 181
            :.........|..|       |....:.|...:  .|:|.|...:|..:|:|:|.  ..|.|.| 
Mosquito    69 FALGFSNEIVGYPR-------FSLNQNHSDGVY--NLRITNTSYDDAALYQCQVGPAKHNHPIR- 123

  Fly   182 LKINLTVIVPP 192
            .:..|||:..|
Mosquito   124 AQAKLTVLATP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 22/110 (20%)
Ig 210..281 CDD:472250
Ig strand B 218..222 CDD:409353
Ig strand C 232..236 CDD:409353
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
LOC1272537XP_311453.2 IG_like 38..130 CDD:214653 23/112 (21%)
Ig strand B 49..53 CDD:409353 1/3 (33%)
Ig strand C 61..65 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/5 (20%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.