DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and LOC1271142

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_061513769.1 Gene:LOC1271142 / 1271142 VectorBaseID:AGAMI1_008412 Length:386 Species:Anopheles gambiae


Alignment Length:406 Identity:86/406 - (21%)
Similarity:139/406 - (34%) Gaps:110/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 SPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTA 241
            :|.|:.:|. |:...|....:|.:       |::........:..|.|.  .|.|: |..||.||
Mosquito    22 APVRSQQIE-TIPSSPSYHTLYER-------NLDLLCRAGKPIDQCNVR--LPGPS-TDTLDVTA 75

  Fly   242 IDESFEQRPDG-KTINHLSYPNVG---RQHLNSRL---MCVA--------SNTNLTPPNNRVVIL 291
                 ...|.| |.|...|....|   ....|.|:   :|:.        |...|   ..||...
Mosquito    76 -----NVLPGGVKRIGDFSRGECGVRLATFTNERIGKFVCIVTIDGQQFESAIEL---RKRVPPR 132

  Fly   292 DVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPDNQSLSI 356
            ...|| ||......|..:.|::.....|.|....|.|.:||....|.:          |..:|..
Mosquito   133 PTELK-IAKATALIDGGLRANQLLKARCISRNGLPVANLTWLLDGKPI----------DESALKP 186

  Fly   357 LTFTPGREDDG-----------KYLTCRAENQFIDGSAIE-------------DKWRLIVHYQPT 397
            ...|...:.||           .|:| .|||    |..:|             :.:.|.:.:.|.
Mosquito   187 AQITAEEQQDGTSLETIQQEVHMYVT-PAEN----GQTLECVTNHPAFKPELRNSFLLNIKFPPE 246

  Fly   398 TTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGVILSDQSLVLQSVS 462
            ..    ..::.|::.....|.....:.|||||: ..|..||:.::...||.:.   |:.:.:..|
Mosquito   247 EI----PHIHIDELPASGSATINITIHANPKPF-TRWTVNGRHIKEGESADIY---QAYIPRPTS 303

  Fly   463 RASAGDYTCLAVNSEGKGPSNPVTLRIRYAPICATDHEELL-----GALKHETLPLKC-EVDSS- 520
              :.|:|..|..|::                 |:.:...|.     .||..:|..:|. .||:: 
Mosquito   304 --AKGEYRVLLKNND-----------------CSMERPSLFTLEATNALGTQTYVIKAVRVDANE 349

  Fly   521 --PPADSFQWTFNSSG 534
              |..:...:|.:|:|
Mosquito   350 VEPGRNDDYYTDDSNG 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230 3/10 (30%)
Ig 210..281 CDD:472250 19/85 (22%)
Ig strand B 218..222 CDD:409353 0/3 (0%)
Ig strand C 232..236 CDD:409353 1/3 (33%)
Ig <317..392 CDD:472250 20/98 (20%)
Ig strand C 329..333 CDD:409353 1/3 (33%)
Ig strand E 355..359 CDD:409353 0/3 (0%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 1/15 (7%)
Ig 411..479 CDD:472250 17/67 (25%)
Ig strand B 417..421 CDD:409353 1/3 (33%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 1/4 (25%)
Ig 494..576 CDD:472250 12/50 (24%)
Ig strand B 511..515 CDD:409353 0/3 (0%)
Ig strand C 525..529 CDD:409353 0/3 (0%)
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353
fn3 593..675 CDD:394996
LOC1271142XP_061513769.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.