DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and Cd22

DIOPT Version :9

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_006539552.1 Gene:Cd22 / 12483 MGIID:88322 Length:879 Species:Mus musculus


Alignment Length:618 Identity:142/618 - (22%)
Similarity:221/618 - (35%) Gaps:149/618 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LPCDISPQERDDAVYMVLWFREGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHPAQL 155
            :.|.::..........|.||:  ||.|:.:.::...|                       ..::|
Mouse   287 MTCRVNSSNPKLRTVAVSWFK--DGRPLEDQELEQEQ-----------------------QMSKL 326

  Fly   156 KIDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPPD--RPVIYGQNRHEKAGNVESFSEGNDI 218
            .:.::..:..|.|||:......|..:.::.|||...|:  |..||          .....||..:
Mouse   327 ILHSVTKDMRGKYRCQASN
DIGPGESEEVELTVHYAPEPSRVHIY----------PSPAEEGQSV 381

  Fly   219 VLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVASNTNLTP 283
            .|.||........|.|||.:...|        .|.|...|..|.|...|..: ..|:|.|.....
Mouse   382 ELICESLASPSATNYTWYHNRKPI--------PGDTQEKLRIPKVSPWHAGN-YSCLAENRLGHG 437

  Fly   284 PNNRVVILDVNLKPIAVHILTKD--RFVSADRTYDVECKSSGSKPPALITWW--KGSKQLKKLTK 344
            ..::...|||:..|.||..:.:.  ..:..| :..:.|:.:.|.|......|  :||..:.|   
Mouse   438 KIDQEAKLDVHYAPKAVTTVIQSFTPILEGD-SVTLVCRYNSSNPDVTSYRWNPQGSGSVLK--- 498

  Fly   345 NFNEPDNQSLSILTFTPGREDDGKYLTCRAENQFIDGSAIEDKWR----LIVHYQP--TTTLKIG 403
                |....:..:|:      |...::|.|.|.       :..|.    |.|||.|  ...||:.
Mouse   499 ----PGVLRIQKVTW------DSMPVSCAACNH-------KCSWALPVILNVHYAPRDVKVLKVS 546

  Fly   404 SSLNPDDIKEGDDAYFEC-IVLANPKPYKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASAG 467
            .:   .:|:.|.....:| ...:||...:..|..||..:|..         :.|...|||...:|
Mouse   547 PA---SEIRAGQRVLLQCDFAESNPAEVRFFWKKNGSLVQEG---------RYLSFGSVSPEDSG 599

  Fly   468 DYTCLAVNSEGKGPSNPVTLRIRYAP------ICATDHEELLGALKHETLPLKCEVDSSPPADSF 526
            :|.|:..||.|:..|....|::.|||      |...||     .::.:...|.||.|::||...:
Mouse   600 NYNCMVNNSIGETLSQAWNLQVLYAPRRLRVSISPGDH-----VMEGKKATLSCESDANPPISQY 659

  Fly   527 QWTFNSSGEQTELPARLHSSETGMSRLNYTPSTDLDYGTISCWAKNSIGTQKSP----------- 580
            .| |:|||:.      ||||.   .:|...|......|:..|...|.|||.:||           
Mouse   660 TW-FDSSGQD------LHSSG---QKLRLEPLEVQHTGSYRCKGTNGIGTGESPPSTLTVYYSPE 714

  Fly   581 CVFQIVAAGRPFPLQNCSVT------------NQSVDSLQVDCLEGFDGGLPQGFMLELVELNTL 633
            .:.:.||.|..|.|..|.:.            |:|...||    |...|   |.|.:.      .
Mouse   715 TIGKRVALGLGFCLTICILAIWGMKIQKKWKQNRSQQGLQ----ENSSG---QSFFVR------N 766

  Fly   634 RLARNITVSHTPVTFVIDN--LDQAATYRMVIF 664
            :.||...:|..|.:....|  :|...:|.::.|
Mouse   767 KKARRTPLSEGPQSQGCYNPAMDDTVSYAILRF 799

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:284989 15/96 (16%)
IG_like 80..188 CDD:214653 15/96 (16%)
Ig 210..281 CDD:299845 19/70 (27%)
Ig 319..392 CDD:299845 15/78 (19%)
IG_like 319..383 CDD:214653 13/65 (20%)
IG_like 412..489 CDD:214653 20/77 (26%)
IGc2 413..478 CDD:197706 17/65 (26%)
Ig_3 509..572 CDD:290638 19/62 (31%)
fn3 593..675 CDD:278470 18/86 (21%)
Cd22XP_006539552.1 Ig 37..145 CDD:386229
Ig 164..250 CDD:386229
Ig_3 271..345 CDD:372822 13/82 (16%)
IGc2 377..435 CDD:197706 19/66 (29%)
IGc2 554..610 CDD:197706 17/64 (27%)
Ig_3 629..695 CDD:372822 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.