DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and ceacam8l

DIOPT Version :10

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_031761715.1 Gene:ceacam8l / 101730286 XenbaseID:XB-GENE-22169429 Length:407 Species:Xenopus tropicalis


Alignment Length:270 Identity:71/270 - (26%)
Similarity:107/270 - (39%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 TWWKGSK------------QLKKLTK------NFNEPDNQSLSILTFTPGREDDGKY--LTCRAE 375
            :|:|||.            ....:||      ..|...|.||.|....|  .|.|.|  |...||
 Frog    59 SWYKGSSADTNNQIFSVIPSANSVTKGPQYFPRANWLPNGSLQISGLVP--TDQGNYTVLMYTAE 121

  Fly   376 NQFIDGSAIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKE 440
                  |..:|...|.| |:|.::..|.:     |.||..:.....:..:.....::.|..||..
 Frog   122 ------STTQDTVSLPV-YEPVSSSGIST-----DNKEPQENQPVTLTCSANNAEQILWSKNGVP 174

  Fly   441 LQHNISAGVILS--DQSLVLQSVSRASAGDYTCLAVNSEGKGPSNPVTLRIRYAPICATDHEELL 503
            |    ..|:.||  :::|....:||:..|.|.|.|.|:..|..|:|.||.:.|.|    ::.::.
 Frog   175 L----PPGLTLSADNRTLTFPRISRSDTGQYRCEASNAVSKIISDPYTLTVNYGP----ENLKIK 231

  Fly   504 GALK----HETLPLKCEVDSSPPADSFQWTFNSSGEQTELPARLHSSETGMSRLNYTPSTDLDYG 564
            |.|:    :.| .|:|..| |.||.::||.||.:..:::.........|..|..|||        
 Frog   232 GTLQVTSGYST-SLECSAD-SVPAPTYQWKFNGTNLESQTNTLYIQQATPESAGNYT-------- 286

  Fly   565 TISCWAKNSI 574
               |...||:
 Frog   287 ---CIGTNSV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:462230
Ig 210..281 CDD:472250
Ig strand B 218..222 CDD:409353
Ig strand C 232..236 CDD:409353
Ig <317..392 CDD:472250 21/80 (26%)
Ig strand C 329..333 CDD:409353 0/1 (0%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 2/6 (33%)
Ig strand G 385..388 CDD:409353 1/2 (50%)
Ig 411..479 CDD:472250 17/69 (25%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 21/85 (25%)
Ig strand B 511..515 CDD:409353 1/3 (33%)
Ig strand C 525..529 CDD:409353 1/3 (33%)
Ig strand E 551..555 CDD:409353 1/3 (33%)
Ig strand F 566..570 CDD:409353 1/3 (33%)
fn3 593..675 CDD:394996
ceacam8lXP_031761715.1 Ig 29..132 CDD:472250 21/80 (26%)
Ig strand B 44..48 CDD:409353
Ig strand C 57..61 CDD:409353 0/1 (0%)
Ig strand E 98..102 CDD:409353 2/3 (67%)
Ig strand F 112..117 CDD:409353 1/4 (25%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig 139..222 CDD:472250 24/91 (26%)
Ig strand B 154..158 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 186..190 CDD:409353 1/3 (33%)
Ig strand F 200..205 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig_3 236..291 CDD:464046 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.