DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and si:ch211-66e2.5

DIOPT Version :9

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_001920347.3 Gene:si:ch211-66e2.5 / 100150500 ZFINID:ZDB-GENE-131121-180 Length:302 Species:Danio rerio


Alignment Length:285 Identity:69/285 - (24%)
Similarity:107/285 - (37%) Gaps:52/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GNDIVLSCEVSGGRPRPNVTW----YLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCV 275
            |:.:.:||..|  ||...:.|    ...:|..|.|.:.|.|..| :.:..|             :
Zfish    36 GDPVTVSCVAS--RPVRVLGWESIIAASHTQHDLSVQWRVDSLT-DWIEEP-------------I 84

  Fly   276 ASNTNLTPPNNRVVILDVNL--KP--IAVHILTKDRFVSADRTYDVECKSSGSKPP--ALITWWK 334
            ......|.|......|::.|  ||  :::.::.....|...|.|.::|:.....|.  .::.|::
Zfish    85 CYGVFFTAPRQCEEKLNLVLYKKPDSVSISLVNHSSPVVEGREYQLQCEVHNVAPVQYLVLRWYR 149

  Fly   335 GSKQLKKLTKNFNE--PDN--QSLSILTFTPGREDDGKYLTCRAENQF-IDG-----SAIEDKWR 389
              :|.:....:|:|  |..  |..|.|...|.|.:||....|.||.|. .:|     :.:.....
Zfish   150 --EQTEVYNHSFSELTPATPVQVSSTLLIVPNRAEDGAQYRCEAELQLGPEGPQPPPTVLSPSLN 212

  Fly   390 LIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGVILSDQ 454
            :.|||.|.........|   ::.||.:...:|....||.|..: |  ....||.......:|.|.
Zfish   213 IAVHYPPDFRSPKEEQL---EVSEGSEVVLDCTAEGNPLPVYI-W--TSPNLQEKADDQPVLKDA 271

  Fly   455 SLVLQSVSRASAGDYTCLAVNSEGK 479
            ||        |.|.|||.|.|..||
Zfish   272 SL--------SPGVYTCTASNILGK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:284989
IG_like 80..188 CDD:214653
Ig 210..281 CDD:299845 14/69 (20%)
Ig 319..392 CDD:299845 19/84 (23%)
IG_like 319..383 CDD:214653 19/75 (25%)
IG_like 412..489 CDD:214653 22/68 (32%)
IGc2 413..478 CDD:197706 20/64 (31%)
Ig_3 509..572 CDD:290638
fn3 593..675 CDD:278470
si:ch211-66e2.5XP_001920347.3 Ig 108..203 CDD:299845 23/96 (24%)
IG_like 122..196 CDD:214653 21/75 (28%)
IG_like 227..293 CDD:214653 23/76 (30%)
Ig_2 227..284 CDD:290606 20/70 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.