DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and si:ch211-66e2.3

DIOPT Version :9

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001108576.1 Gene:si:ch211-66e2.3 / 100141487 ZFINID:ZDB-GENE-080226-7 Length:315 Species:Danio rerio


Alignment Length:296 Identity:73/296 - (24%)
Similarity:112/296 - (37%) Gaps:75/296 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GNDIVLSCEVS------------GGRPRPN---VTWYLDNTAIDESFEQRPDGKTINHLSYPNVG 264
            |:.:.::|..|            ||.|...   :||.:....   .:|.:|.      ..|.|.|
Zfish    38 GDPVSVNCSTSVTHMGMGWESTVGGVPLSTASLITWRVSELT---DWEIQPP------FCYINYG 93

  Fly   265 RQHLNSRLMCVASNTNLTPPNNRVVILDVNL--KPIAVHILTKDRFVSADRTYDVECKSSGSKPP 327
            :|       |             .|.|.|.:  .|.:|.|.|.::.:.....|:::|......|.
Zfish    94 KQ-------C-------------EVALPVTVYKTPDSVSISTVNQTMIEGNQYELQCDVYNVAPV 138

  Fly   328 ALIT--WWKGSKQLKK--LTKNFNEPDNQSLSILTFTPGREDDGKYLTCRAE-NQFIDG-----S 382
            ..:|  |:||...:.:  .|.....|.|:: |.|...|.|.|||..:.|..| |...:|     :
Zfish   139 QKLTVNWYKGETLVDQTSFTDTIKSPVNKT-SKLLIRPDRADDGAQIRCEVELNLGEEGPQPPPT 202

  Fly   383 AIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISA 447
            ...:..|:.|:|:|.      .|.:.:.|...:|....|.|.|||... .||  :.:.|...||:
Zfish   203 NTSEPLRITVYYKPK------HSNSTEIISWSNDVSLNCTVKANPAAV-YSW--HSEHLTEKISS 258

  Fly   448 GVILSDQSLVLQSVSRASAGDYTCLAVNSEGKGPSN 483
            .||.|         |..|.|:|||:|.|..|:...|
Zfish   259 SVIQS---------STLSPGNYTCIATNFLGEDKKN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:284989
IG_like 80..188 CDD:214653
Ig 210..281 CDD:299845 15/80 (19%)
Ig 319..392 CDD:299845 21/82 (26%)
IG_like 319..383 CDD:214653 20/73 (27%)
IG_like 412..489 CDD:214653 24/72 (33%)
IGc2 413..478 CDD:197706 22/64 (34%)
Ig_3 509..572 CDD:290638
fn3 593..675 CDD:278470
si:ch211-66e2.3NP_001108576.1 Ig 108..208 CDD:299845 25/100 (25%)
Ig_3 215..277 CDD:290638 24/79 (30%)
IG_like 230..288 CDD:214653 24/68 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.